ESTScan Details for Unigene SGN-U234594

Score 
170
Direction 
Forward
Predicted Peptide Sequence 
MTKQLIDDGGKENAAVAAEEQKTSYVVNPDQGIKSANGLNKSKKSVHWSQELVTESYVQRTTGNRGSNPYLVHSPAPGNNSAX
Predicted Coding Sequence 
ATGACGAAGCAGCTTATCGACGATGGCGGGAAAGAGAACGCGGCGGTGGCGGCAGAGGAGCAGAAGACCAGCTACGTTGTGAATCCTGAT
CAAGGAATCAAATCGGCGAACGGTTTGAATAAATCGAAGAAATCGGTGCATTGGAGTCAGGAATTGGTGACGGAGTCGTACGTGCAGAGA
ACAACCGGCAACAGGGGATCGAATCCTTACTTAGTTCATTCTCCGGCTCCGGGCAACAATTCTGCTTXX\
Edits in Original Sequence 
TACTTGTAGATATTTTTACCTCTTTTCTCTCGTCGGCG(5')ATGACGAAGCAGCTTATCGACGATGGCGGGAAAGAGAACGCGGCGGTG
GCGGCAGAGGAGCAGAAGACCAGCTACGTTGTGAATCCTGATCAAGGAATCAAATCGGCGAACGGTTTGAATAAATCGAAGAAATCGGTG
CATTGGAGTCAGGAATTGGTGACGGAGTCGTACGTGCAGAGAACAACCGGCAACAGGGGATCGAATCCTTACTTAGTTCATTCTCCGGCT
CCGGGCAACAATTCTGCTTXX\(3')CTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan