ESTScan Details for Unigene SGN-U234700

Score 
405
Direction 
Forward
Predicted Peptide Sequence 
MGEVNYMREEDVKLDAVRARFSNVLKRHSELAERLSRDSDKSIFDRLQKEFEAARASQTQELILKGEQWNDGLLATIRERVHMEAERKAM
QIPGDTTQLPIPFHDKITYKVGNKVICCLDGARIGIQYDTSYAGESCDLYHCVLESKSFLEKMTVLEHTIPFFLPIREAENEFLSSNAIR
FIDHVWRSVASX
Predicted Coding Sequence 
ATGGGGGAAGTGAATTATATGCGAGAGGAGGATGTAAAGCTGGACGCTGTACGGGCTAGATTTTCAAATGTTCTTAAAAGACATTCAGAG
CTAGCAGAGCGTCTTTCTAGGGATTCTGACAAGTCGATTTTTGATCGTCTACAAAAGGAATTTGAAGCTGCACGTGCTTCTCAAACTCAA
GAACTCATCTTAAAAGGTGAGCAATGGAATGATGGCTTATTGGCAACAATAAGAGAGCGGGTACACATGGAGGCTGAGAGAAAGGCTATG
CAAATACCAGGGGATACAACCCAGTTGCCAATTCCATTTCATGATAAAATTACCTATAAAGTTGGGAATAAGGTTATTTGTTGCTTGGAT
GGAGCAAGGATAGGCATACAATATGATACTTCATATGCAGGCGAATCTTGTGACCTATACCACTGTGTGCTTGAGAGCAAGTCATTTCTG
GAGAAGATGACTGTTCTGGAACATACAATTCCTTTTTTCTTGCCAATACGTGAAGCTGAAAATGAGTTTCTCTCGTCAAATGCAATAAGA
TTTATTGACCATGTTTGGAGATCTGTTGCAAGCGXX\
Edits in Original Sequence 
GGGGAGCTGAAATCGGAAGACGACTGATTTTTATTCATTCAGTTTATGAAGATTACAGTAGCTTCTATGTTTTGAATAACTCTTGTTTAT
CAAATTGGGAACAAGGAGTGAAGCTGTTA
(5')ATGGGGGAAGTGAATTATATGCGAGAGGAGGATGTAAAGCTGGACGCTGTACGGGCT
AGATTTTCAAATGTTCTTAAAAGACATTCAGAGCTAGCAGAGCGTCTTTCTAGGGATTCTGACAAGTCGATTTTTGATCGTCTACAAAAG
GAATTTGAAGCTGCACGTGCTTCTCAAACTCAAGAACTCATCTTAAAAGGTGAGCAATGGAATGATGGCTTATTGGCAACAATAAGAGAG
CGGGTACACATGGAGGCTGAGAGAAAGGCTATGCAAATACCAGGGGATACAACCCAGTTGCCAATTCCATTTCATGATAAAATTACCTAT
AAAGTTGGGAATAAGGTTATTTGTTGCTTGGATGGAGCAAGGATAGGCATACAATATGATACTTCATATGCAGGCGAATCTTGTGACCTA
TACCACTGTGTGCTTGAGAGCAAGTCATTTCTGGAGAAGATGACTGTTCTGGAACATACAATTCCTTTTTTCTTGCCAATACGTGAAGCT
GAAAATGAGTTTCTCTCGTCAAATGCAATAAGATTTATTGACCATGTTTGGAGATCTGTTGCAAGCGXX\(3')CG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan