ESTScan Details for Unigene SGN-U234743

Score 
317
Direction 
Reverse
Predicted Peptide Sequence 
NTSASPEEMKKVALKRYNKMRGNAPERLVSGSDDFTMFLWEPAVSKHPKTRMTGHQQLVNHVYFSPDGQWIASASFDKSVKLWNGTTGKF
VAAFRGHVGPVYQISWSADSRLLLSGSKDSTLKVWDIRTKKLKQDLPGHADEVFAVDWSPDGEKVASGGKDRVLKLWMGRNKGDSTPIPM
KLLFLPGKFKAPTFIY
Predicted Coding Sequence 
AACACTTCXGCATCTCCTGAGGAAATGAAAAAGGTAGCACTGAAAAGGTACAACAAAATGAGAGGTAATGCCCCTGAGAGGTTGGTATCA
GGATCAGATGATTTCACAATGTTTCTATGGGAGCCTGCTGTCAGCAAGCACCCAAAAACTCGCATGACAGGTCATCAACAGCTGGTTAAT
CACGTTTATTTTTCTCCGGATGGTCAATGGATAGCAAGTGCTTCATTCGATAAGTCAGTAAAATTATGGAATGGAACCACAGGAAAATTT
GTTGCTGCATTCCGAGGCCATGTTGGACCTGTTTATCAGATAAGCTGGTCAGCCGACAGTAGGCTACTTTTGAGTGGGAGCAAAGATTCA
ACCTTGAAGGTTTGGGATATCCGGACAAAAAAATTGAAACAAGACCTTCCCGGCCATGCTGACGAGGTTTTCGCGGTCGACTGGAGTCCA
GACGGCGAAAAAGTAGCATCTGGTGGTAAAGATAGAGTTCTGAAGCTATGGATGGGAAGAAACAAGGGTGACTCCACCCCTATACCAATG
AAGCTCTTGTTTTTGCCTGGAAAATTCAAGGCCCCTACTTTTATTTATTAG\
Edits in Original Sequence 
(5')AACACTTCXGCATCTCCTGAGGAAATGAAAAAGGTAGCACTGAAAAGGTACAACAAAATGAGAGGTAATGCCCCTGAGAGGTTGGT
ATCAGGATCAGATGATTTCACAATGTTTCTATGGGAGCCTGCTGTCAGCAAGCACCCAAAAACTCGCATGACAGGTCATCAACAGCTGGT
TAATCACGTTTATTTTTCTCCGGATGGTCAATGGATAGCAAGTGCTTCATTCGATAAGTCAGTAAAATTATGGAATGGAACCACAGGAAA
ATTTGTTGCTGCATTCCGAGGCCATGTTGGACCTGTTTATCAGATAAGCTGGTCAGCCGACAGTAGGCTACTTTTGAGTGGGAGCAAAGA
TTCAACCTTGAAGGTTTGGGATATCCGGACAAAAAAATTGAAACAAGACCTTCCCGGCCATGCTGACGAGGTTTTCGCGGTCGACTGGAG
TCCAGACGGCGAAAAAGTAGCATCTGGTGGTAAAGATAGAGTTCTGAAGCTATGGATGGGAtAGAAACAAGGGTGACTCCACCCCTATAC
CAATGAAGCTCTTGTTTTTaGCCTGGAAAATTCAAGGCCCCTACTTTTATTTATTAG\(3')ATATATAAAATATGTAATTCAAGTAGTA
ATCGCCATTCTTATTATTATTAATATTAATGATATACGTGAGCTTTTTACCAGCCATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan