Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U234781

Score 
381
Direction 
Reverse
Predicted Peptide Sequence 
NGDEQVIHRCITSSAIILDPDMNPRLGCFALAEFLTRNEHSHHVYSFGVVLLEIVSGQMAVDFRRPEALLVNRVHEFEVQKRPYEQLADW
RLNGNFNTRELIRLVKLGMACTRYDPESRPSMRQIVNILDGHDQWLMENGRKKESPEEWRTRNASAXVPRKENPSSWYTMIIA
Predicted Coding Sequence 
AATGGXGATGAACAGGTGATACACAGATGCATCACATCATCTGCCATCATTCTTGATCCAGATATGAACCCAAGGCTTGGTTGCTTTGCT
CTTGCTGAATTCTTGACTCGAAATGAGCATAGCCATCATGTTTATAGCTTTGGTGTAGTTCTGCTTGAGATAGTTAGTGGTCAGATGGCA
GTAGATTTCCGCCGGCCTGAGGCTTTGTTGGTTAATCGAGTTCATGAATTCGAGGTGCAAAAAAGGCCATACGAACAACTTGCAGATTGG
AGGTTGAATGGAAACTTCAACACCAGGGAACTGATCAGGCTAGTCAAATTAGGAATGGCTTGCACTAGATACGATCCTGAATCAAGACCG
AGCATGAGGCAGATAGTGAACATTCTCGATGGACATGATCAATGGTTAATGGAAAATGGACGAAAGAAGGAGAGCCCGGAAGAATGGAGA
ACAAGAAATGCTTCTGCTXTTGTCCCTCGTAAGGAGAATCCAAGCTCTTGGTATACAATGATCATCGCGTAA\
Edits in Original Sequence 
(5')AATGGXGATGAACAGGTGATACACAGATGCATCACATCATCTGCCATCATTCTTGATCCAGATATGAACCCAAGGCTTGGTTGCTT
TGCTCTTGCTGAATTCTTGACTCGAAATGAGCATAGCCATCATGTTTATAGCTTTGGTGTAGTTCTGCTTGAGATAGTTAGTGGTCAGAT
GGCAGTAGATTTCCGCCGGCCTGAGGCTTTGTTGGTTAATCGAGTTCATGAATTCGAGGTGCAAAAAAGGCCATACGAACAACTTGCAGA
TTGGAGGTTGAATGGAAACTTCAACACCAGGGAACTGATCAGGCTAGTCAAATTAGGAATGGCTTGCACTAGATACGATCCTGAATCAAG
ACCGAGCATGAGGCAGATAGTGAACATTCTCGATGGACATGATCAATGGTTAATGGAAAATGGACGAAAGAAGGAGAGCCCGGAAGAATG
GAGAACAAGAAATGCTTCTGCTXTTGTCCCTCGTAAGGAGAATCCAAGCTCTTGGTATACAATGATCATCGCGTAA\(3')GATGTGAAG
TAGTTACATGTAGATAGAAATGAAAATGAAGCTTTATATCTCAATGTGTTTGTTCTTCTATGTATTCATGGTATGACTATGTTTCTTCAG
CAGAACATTTGTGTAATTTAGTGTGGGCAACTTTGATAGCATCAGATATGCGATTTTTTATGAAATTGATGAGTTTTTTTTCGATAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan