ESTScan Details for Unigene SGN-U234941

Score 
193
Direction 
Reverse
Predicted Peptide Sequence 
LFFAGGGEDSKVYKGNRGGTNPMEILWGHSMTGNSGRGNPKGPKMLVSARDDQTFRKWGPDVRSK
Predicted Coding Sequence 
CTTTTTTTCGCCGGTGGTGGTGAAGATTCAAAGGTGTACAAAGGGAATCGCGGGGGTACAAACCCTATGGAGATCTTGTGGGGCCATTCA
ATGACTGGGAACTCTGGGAGGGGGAATCCTAAAGGGCCTAAAATGCTAGTTTCAGCAAGGGATGATCAAACTTTCCGCAAATGGGGGCCT
GATGTTCGAAGTAAATAG\
Edits in Original Sequence 
(5')CTTTTTTTCGCCGGTGGTGGTGAAGATTCAAAGGTGTACAAAGGGAATCGCGGGGGTACAAACCCTATGGAGATCTTGTGGGGCCA
TTCAATGACTGGGAACTCTGGGAGGGGGAATCCTAAAGGGCCTAAAATGCTAGTTTCAGCAAGGGATGATCAAACTTTCCGCAAATGGGG
GCCTGATGTTCGAAGTAAATAG\(3')GGGCCTGATGTTCGAAGTAAATAGTACCGAGCTGGTATATGCAAATGGATTTTTCTCAATTGC
TAGTTCCATTTCCCAGGAAAATTTGTTTTTTTTCTACAAATTTTGGCATGTTTATTCCCCCCATGTAAATTGGCATAGCTAGAAAAAAAA
TTTTGTTTCCGGGGGTATGTACAACCCCAACGTTGGGGGGTGTAAGTAAAAACTTTTTCCCTAAAGTTTGATTGAAATTAGAAAAAGAAA
GTAAAACTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan