ESTScan Details for Unigene SGN-U234980

Score 
233
Direction 
Forward
Predicted Peptide Sequence 
NLNEHFPFIHCVESLIYHKNYTQWETCFEKLNLRKKLVTDCVGSDRGKELELRHAAETPPHKFVPWVVVDGQPLYTDYREFISYICKAYK
GTAPIPGCSSSDSISFTSKLSTISSTITSFVAQRVKLAASDNPQVMSTYNRAT
Predicted Coding Sequence 
XCAAATTTGAATGAACACTTCCCTTTTATTCACTGTGTGGAAAGTTTGATCTACCATAAGAATTATACACAATGGGAAACGTGTTTCGAA
AAACTGAATTTGAGGAAAAAACTCGTTACTGATTGTGTTGGCAGTGACAGAGGCAAAGAGCTTGAACTACGCCACGCAGCTGAGACACCT
CCGCATAAATTTGTGCCATGGGTTGTTGTTGATGGACAACCGCTTTACACTGACTACAGGGAATTCATAAGCTACATTTGCAAAGCTTAC
AAAGGAACCGCGCCTATCCCCGGTTGTAGCTCATCTGATTCTATAAGTTTCACTTCCAAGTTATCAACTATCAGTTCAACAATTACATCA
TTTGTTGCACAGAGAGTTAAGCTTGCTGCATCTGATAATCCACAGGTTATGTCAACATATAATAGAGCTACTTGA\
Edits in Original Sequence 
(5')XCAAATTTGAATGAACACTTCCCTTTTATTCACTGTGTGGAAAGTTTGATCTACCATAAGAATTATACACAATGGGAAACGTGTTT
CGAAAAACTGAATTTGAGGAAAAAACTCGTTACTGATTGTGTTGGCAGTGACAGAGGCAAAGAGCTTGAACTACGCCACGCAGCTGAGAC
ACCTCCGCATAAATTTGTGCCATGGGTTGTTGTTGATGGACAACCGCTTTACACTGACTACAGGGAATTCATAAGCTACATTTGCAAAGC
TTACAAAGGAACCGCGCCTATCCCCGGTTGTAGCTCATCTGATTCTATAAGTTTCACTTCCAAGTTATCAACTATCAGTTCAACAATTAC
ATCATTTGTTGCACAGAGAGTTAAGCTTGCTGCATCTGcATAATCCACAGGTTATGTCAACATATAATAGAGCTACTTGA\(3')ATGCT
GGTTATGTTTTATGAAATGATGAACTGCATTTGTAAAATATTTATCATAGTTTGAATGATAATGAAGCTGTTCAGTTCTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan