ESTScan Details for Unigene SGN-U235060

Score 
83
Direction 
Reverse
Predicted Peptide Sequence 
IPYFQLIHMDGPHLDFGLKISEEKSIVPGMYFVXPGEKPQNAIKGGPEMFKTLGENALGENNILFGGENIGFVDIAFGGYFLWVEIIEEI
VGVKLLNPPNFPRINNWVKKFKEVPTIKGNFPNRGGKFVYLKNARGGMLHFLNEAGSSFE
Predicted Coding Sequence 
XXAATCCCTTACTTTCAACTGATTCATATGGACGGGCCCCATCTTGATTTTGGGCTAAAAATATCXGAAGAAAAGTCCATAGTTCCTGGA
ATGTATTTTGTTXACCCTGGGGAAAAGCCACAAAATGCTATAAAGGGGGGCCCTGAAATGTTCAAAACCCTAGGGGAAAATGCTTTGGGG
GAAAACAATATATTATTTGGGGGGGAAAATATTGGATTTGTTGACATAGCTTTTGGGGGTTATTTTCTTTGGGTGGAAATTATTGAAGAA
ATTGTTGGGGTTAAGTTACTTAATCCCCCCAATTTTCCTCGGATTAACAATTGGGTAAAAAAATTCAAAGAAGTTCCAACCATCAAAGGT
AATTTTCCTAATCGGGGTGGGAAGTTTGTGTACCTGAAAAATGCTAGGGGGGGGATGTTGCATTTCCTTAACGAGGCCGGCTCGAGCTTT
GAGTAA\
Edits in Original Sequence 
(5')XXAATCCCTTACTTTCAACTGATTCATATGGACGGGCCCCATCTTGATTTTGGGCTAAAAATATCXGAAGAAAAGTCgCATAGTTC
CTGGAATGTATTTTGTTXACCCTGGGGAAAAGCCACAAAATGCTATAAAGGGGGGCCCTGAAATGTTCAAAACCCTAGGGGAAAATGCTT
TGGGGGAAAACAATATATTATTTGGGGGGGAAAATATTGGATTTGTTGACATAGCTTTTGGGGGTTATTTTCTTTGGGTGGAAATTATTG
AAGAAATTGTTGGGGTTAAGTTACTTAATCCCCCCAATTTTCCTCGGATTAACAATTGGGTAAAAAAATTCAAAGAAGTTCCAACCATCA
AAGGTAATTTTCCTAATCGGGGTGGGAAGTTTGTGTACCTGAAAAATGCTAGGGGGGGGATGTTaGCATTTCCTTAACGAGGCCGGCTCG
AGCTTTGAGTAA\(3')AGCATTTCCTTAACGAGGCCGGCTCGAGCTTTGAGTAAAGAATTGTCTTTTTTAGTCAGAAAACGCTTTATAT
TTTTATGTGGGGCTTTCCGGGGAATCCCGTTAAAAAATTTATGGGTTCAAGTTGCTTAGGCCCTGTATTTCCAAAAAAGTATACGGATTT
TTCCCCGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan