ESTScan Details for Unigene SGN-U235316

Score 
421
Direction 
Forward
Predicted Peptide Sequence 
IHISGYPKKQETFARISGYCEQNDIHSPCLTILESLLFSAWLRLPSEVDVETQKAFVDEVMELVELSPLRGALVGLPGVDGLSTEQRKRL
TIAVELVANPSIVFMDEPTSGLDARAAAIVMRTVRNIVNTGRTIVCTIHQPSIDIFESFDELLFMKRGGELIYAGPLGPKSCQLIEYFEA
IEGVPRINPGYNPAHGMLGX
Predicted Coding Sequence 
ATCCATATATCGGGTTACCCAAAGAAGCAAGAAACGTTTGCTAGAATATCTGGCTACTGTGAGCAAAATGACATCCACTCACCTTGCTTG
ACCATTCTTGAATCACTACTGTTTTCTGCTTGGCTACGTTTGCCATCAGAGGTTGACGTAGAGACACAAAAGGCATTTGTTGACGAGGTA
ATGGAGCTTGTGGAGCTGAGTCCACTAAGAGGAGCTTTGGTTGGTTTGCCTGGAGTTGATGGACTGTCAACAGAACAAAGGAAACGGCTA
ACAATTGCTGTTGAACTAGTAGCTAACCCTTCTATTGTGTTCATGGATGAACCTACATCTGGATTGGATGCAAGAGCTGCAGCTATTGTA
ATGAGGACTGTACGTAACATTGTGAACACCGGCCGAACAATTGTTTGCACAATCCACCAGCCCAGCATTGACATTTTTGAATCATTTGAT
GAGCTNTTGTTTATGAAGCGTGGAGGAGAGCTCATTTATGCAGGACCTCTTGGTCCTAAATCTTGCCAGTTGATAGAGTATTTTGAGGCA
ATTGAAGGAGTACCCAGAATAAACCCTGGATATAATCCAGCTCATGGGATGTTGGGAGXX\
Edits in Original Sequence 
(5')ATCCATATATCGGGTTACCCAAAGAAGCAAGAAACGTTTGCTAGAATATCTGGCTACTGTGAGCAAAATGACATCCACTCACCTTG
CTTGACCATTCTTGAATCACTACTGTTTTCTGCTTGGCTACGTTTGCCATCAGAGGTTGACGTAGAGACACAAAAGGCATTTGTTGACGA
GGTAATGGAGCTTGTGGAGCTGAGTCCACTAAGAGGAGCTTTGGTTGGTTTGCCTGGAGTTGATGGACTGTCAACAGAACAAAGGAAACG
GCTAACAATTGCTGTTGAACTAGTAGCTAACCCTTCTATTGTGTTCATGGATGAACCTACATCTGGATTGGATGCAAGAGCTGCAGCTAT
TGTAATGAGGACTGTACGTAACATTGTGAACACCGGCCGAACAATTGTTTGCACAATCCACCAGCCCAGCATTGACATTTTTGAATCATT
TGATGAGCTNTTGTTTATGAAGCGTGGAGGAGAGCTCATTTATGCAGGACCTCTTGGTCCTAAATCTTGCCAGTTGATAGAGTATTTTGA
GGCAATTGAAGGAGTACCCAGAATAAgACCCTGGATATAATCCAGCTCATGGGATGTTGGGAGXX\(3')AGGTTACCTTCGTCAGTAGA
AGAAACTCGAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan