ESTScan Details for Unigene SGN-U235387

Score 
-5
Direction 
Reverse
Predicted Peptide Sequence 
FSLKPDPIQDGFVKAIEGGKFVPRAIPKVPGKFLAEEFRGDVTDSRQESGVRVPKPPARTLFVDVTKPVPVRARDKGFVGRCLPVGDQGG
VSFAEENMRGIRFNVVDVTLHADAVHRGGGQIIPTCGRAIYAAEITAAPRLMEPVYLVEIQCPERAVGGIYGVLNRRRGHVIAEEPRPGT
PLYNVKAYLPVNESFGFTADLRANTAGQAFPQXRVRPLAGPEHRSLEKGTKAYEIVMAARKRKGLKDALPDLNDYEDKLNRRARDLCSLW
Predicted Coding Sequence 
XXTTTTTCCCTCAAGCCGGACCCCATCCAAGATGGTTTTGTTAAGGCGATCGAAGGGGGAAAGTTTGTCCCCCGGGCCATTCCCAAGGTT
CCCGGCAAATTCCTCGCCGAAGAATTTCGGGGGGACGTCACCGACTCCCGCCAAGAATCGGGTGTTCGGGTCCCGAAACCCCCGGCTCGA
ACCCTCTTCGTGGACGTCACCAAGCCCGTTCCAGTACGTGCTCGAGATAAAGGATTCGTGGGTCGCTGCCTTCCAGTGGGCGACCAAGGA
GGXGTGTCATTCGCTGAGGAGAACATGCGGGGCATCCGCTTCAACGTCGTCGACGTGACCCTGCACGCCGATGCCGTCCACCGTGGTGGC
GGTCAGATCATCCCCACCTGCGGTCGCGCCATATACGCCGCCGAGATCACCGCCGCTCCCCGCCTCATGGAGCCCGTCTACCTCGTCGAG
ATCCAGTGCCCCGAGCGCGCTGTCGGTGGCATCTACGGTGTGCTCAACCGCCGCCGTGGTCACGTCATCGCTGAGGAGCCTCGCCCCGGC
ACTCCTCTCTACAACGTCAAGGCTTACCTGCCTGTGAACGAGTCTTTCGGCTTCACTGCCGATCTCCGCGCCAACACCGCCGGCCAGGCC
TTCCCTCAGXTGCGTGTTCGACCACTGGCAGGTCCTGAGCACCGATCCCTTGAGAAGGGCACCAAGGCTTACGAGATTGTCATGGCCGCT
CGTAAGCGCAAGGGTCTCAAGGATGCCCTCCCCGACCTCAACGACTACGAGGACAAGCTGAATCGTCGCGCGCGTGACCTTTGTTCCCTT
TGG\
Edits in Original Sequence 
(5')XXTTTTTCCCTCAAGCCGGACCCCATCCAAGATGGTTTTGTTAAGGCGATCGAAGGGGGAAAGTTTGTCCCCCGGGCCATTCCCAA
GGTTCCCGGCAAATTCCTCGCCGAAGAATTTCGGGGGGACGTCACCGACTCCCGCCAAGAATCGGGTGTTCGGGTCCCGAAACCCCCGGC
TCGAACCCTCTTCGTGGACGTCACCAAGCCCGTTCCAGTACGTGCTCGAGATAAAGGATTCGTGGGTCGCTGCCTTCCAGTGGGCGACCA
AGGAGGXGTGTCATTCGCTGAGGAGAACATGCGGGGCATCCGCTTCAACGTCGTCGACGTGACCCTGCACGCCGATGCCGTCCACCGTGG
TGGCGGTCAGATCATCCCCACCTGCGGTCGCGCCATATACGCCGCCGAGATCACCGCCGCTCCCCGCCTCATGGAGCCCGTCTACCTCGT
CGAGATCCAGTGCCCCGAGCGCGCTGTCGGTGGCATCTACGGTGTGCTCAACCGCCGCCGTGGTCACGTCATCGCTGAGGAGCCTCGCCC
CGGCACTCCTCTCTACAACGTCAAGGCTTACCTGCCTGTGAACGAGTCTTTCGGCTTCACTGCCGATCTCCGCGCCAACACCGCCGGCCA
GGCCTTCCCTCAGXTGCGTGTTCGACCACTGGCAGGTCCTGAGCACCGATCCCTTcGAGAAGGGCACCAAGGCTTACGAGATTGTCATGG
CCGCTCGTAAGCGCAAGGGTCTCAAGGATGCCCTCCCCGACCTCAACGACTACGAGGACAAGCTGtAATCGTCGCGCGCGTGACCTTTGT
TCCCTTTGG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan