ESTScan Details for Unigene SGN-U235467

Score 
241
Direction 
Forward
Predicted Peptide Sequence 
NLEGRVKEGRMTQEHYKKACTLLKGVLSYDNFKDVDLVIEDMPDIVSLKQQFFADLDECCPHHCIFASTTCIVNLDLIGERMKPCREIVG
IHFFSSPSVTDLLEIVRTKRTSPQTLVDLLNFX
Predicted Coding Sequence 
AATTTGGAAGGACGTGTTAAGGAAGGAAGAATGACTCAAGAGCATTATAAAAAAGCGTGCACGCTTTTAAAGGGTGTTTTGAGCTATGAT
AACTTCAAAGATGTGGATCTAGTCATAGAGGACATGCCTGACATTGTGTCCTTGAAGCAGCAATTTTTTGCTGATCTTGATGAATGTTGC
CCTCATCACTGCATTTTTGCTTCAACTACTTGTATAGTCAACTTAGATTTGATTGGAGAAAGGATGAAACCATGTAGGGAGATTGTTGGG
ATCCACTTTTTTAGCTCACCCTCTGTCACTGATCTCCTGGAAATTGTCCGAACAAAGAGGACATCCCCTCAAACGCTTGTTGATCTGTTA
AACTTTGXX\
Edits in Original Sequence 
(5')AATTTGGAAGGACGTGTTAAGGAAGGAAGAATGACTCAAGAGCATTATAAAAAAGCGTGCACGCTTTTAAAGGGTGTTTTGAGCTA
TGATAACTTCAAAGATGTGGATCTAGTCATAGAGGACATGCCTGACATTGTGTCCTTGAAGCAGCAATTTTTTGCTGATCTTGATGAATG
TTGCCCTCATCACTGCATTTTTGCTTCAACTACTTGTATAGTCAACTTAGATTTGATTGGAGAAAGGATGAAACCATGTAGGGAGATTGT
TGGGATCCACTTTTTTAGCTCACCCTCTGTCACTGATCTCCTGGAAATTGTCCGAACAAAGAGGACATCCCCTCAAACGCTTGTTGATCT
GTTAAACTTTGXX\(3')TGGAAGGAGGATTCAAAAGACTCCTATTGTAGTTCAGAATTGTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan