Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U235472

Score 
364
Direction 
Forward
Predicted Peptide Sequence 
DSCRYILTVYXRNITAVSSRESKLLAGNRIISQPYEFQVGAPPGKERKRDFVDNPNGLFSAQAAPKPPKAMYTITEGMKVGGKRTVIVPP
EAGYGSRGMNEIPPGATFNLNIELLEVKSSEGSNRCTRTVPYVLPSLFFIVVKVVFTHKHQQLWNQQQFXAHPSRDLNHDLLDKRDGASS
TVPSPLMFFFPSC
Predicted Coding Sequence 
GACTCCTGTAGGTACATTTTGACTGTGTATXATCGTAATATTACTGCGGTTTCAAGTCGAGAATCTAAACTGTTGGCTGGTAATCGGATC
ATTTCACAGCCTTACGAGTTCCAGGTTGGAGCTCCTCCAGGGAAAGAGCGGAAACGTGATTTTGTGGACAATCCAAATGGTTTATTTTCT
GCTCAAGCAGCACCAAAACCTCCAAAGGCAATGTATACAATAACTGAAGGGATGAAAGTTGGAGGAAAGAGGACTGTGATCGTTCCTCCA
GAAGCTGGATATGGTTCAAGGGGAATGAATGAAATTCCGCCAGGGGCTACATTCAACCTGAATATTGAACTATTGGAAGTAAAGTCATCA
GAAGGAAGCAATAGGTGTACCCGGACTGTGCCATATGTTTTGCCTTCCCTCTTCTTCATTGTTGTAAAAGTTGTGTTCACTCATAAACAC
CAACAGCTATGGAATCAACAACAGTTCXCCGCTCACCCTTCACGTGATTTGAACCACGACTTATTGGATAAAAGAGACGGTGCCTCATCA
ACAGTGCCATCTCCTCTCATGTTTTTCTTCCCTTCATGTTAA\
Edits in Original Sequence 
(5')GACTCCTGTAGGTACATTTTGACTGTGTATXATCGTAATATTACTGCGGTTTCAAGTCGAGAATCTAAACTGTTGGCTGGTAATCG
GATCATTTCACAGCCTTACGAGTTCCAGGTTGGAGCTCCTCCAGGGAAAGAGCGGAAACGTGATTTTGTGGACAATCCAAATGGTTTATT
TTCTGCTCAAGCAGCACCAAAACCTCCAAAGGCAATGTATACAATAACTGAAGGGATGAAAGTTGGAGGAAAGAGGACTGTGATCGTTCC
TCCAGAAGCTGGATATGGTTCAAGGGGAATGAATGAAATTCCGCCAGGGGCTACATTCAACCTGAATATTGAACTATTGGAAGTAAAGTC
ATCAGAAcGGAAGCAATAGGTGTACCCGGACTGTGCCATATGTTTTGCCTTCCCTCTTCTTCATTGTTGTAAAAGTTGTGTTCACTCATA
AACACCAACAGCTATGGAATCAACAACAGTTCXCCGCTCACCCTTCACGTGATTTGAACCACGACTTATTGGATAAAAGAGACGGTGCCT
CATCAACAGTGCCATCTCCTCTCATGaTTTTTCTTCCCTTCATGTTAA\(3')AACTGTTCAGTCTTTGTTATGTAGATGAAGTAATTTG
CTTCCAATTTTTTCCACGCTTCTTCATGTGTATGTAAACTTTTACTTCTTAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan