ESTScan Details for Unigene SGN-U235566

Score 
490
Direction 
Reverse
Predicted Peptide Sequence 
FEDDDQKIVKSLRVSCWLNGAAACLKQSYFQEAIKQCCKVLEVESCNVKALYRRAQAFMETADLHLAELDIKKALAIEPQNREVKLIQKT
LKQLQSESNKRDAKLYTTMFARLSNENSSAAKKLKVEETESKNEENVGEINXALTFNWKLNLDEESVLVYIFSKADRXLDPGVYRKQPLY
STYPVKVGVRSVYTPPFLDVTCFGEYIGYVVNASMYSQGNRERLSIQGTTLVPLEIAGFQFILNVKIW
Predicted Coding Sequence 
TTTGAAGATGATGATCAAAAGATAGTTAAATCATTGAGAGTGTCATGCTGGTTGAATGGTGCTGCTGCTTGTCTCAAACAGAGTTATTTC
CAGGAAGCAATCAAGCAATGTTGCAAGGTCTTAGAAGTTGAATCCTGCAATGTGAAAGCATTATATAGGAGAGCGCAAGCATTTATGGAA
ACAGCTGATCTGCACTTGGCTGAACTGGATATCAAGAAGGCACTAGCAATAGAGCCACAAAACAGGGAGGTGAAACTGATACAGAAGACA
CTAAAACAACTCCAATCAGAGAGCAACAAGAGAGACGCAAAGCTCTATACAACAATGTTTGCACGCTTATCAAATGAGAACTCTTCTGCA
GCAAAGAAATTAAAAGTTGAGGAAACGGAGAGCAAGAATGAAGAAAATGTTGGTGAAATCAACAXTGCACTGACATTTAATTGGAAGTTG
AATCTAGATGAAGAATCXGTACTTGTATACATATTTTCTAAAGCTGACAGAGXTCTTGATCCAGGAGTCTACAGGAAACAACCTCTTTAC
TCCACTTACCCTGTAAAGGTAGGGGTAAGGTCTGTGTACACCCCACCCTTTCTAGATGTCACTTGTTTTGGXGAATATATTGGGTATGTT
GTTAACGCGAGCATGTATAGCCAAGGTAATAGAGAAAGGCTTTCCATCCAAGGAACCACACTTGTACCTCTGGAAATAGCTGGTTTTCAG
TTCATTTTAAATGTAAAAATTTGG\
Edits in Original Sequence 
(5')TTTGAAGATGATGATCAAAAGATAGTTAAATCATTGAGAGTGTCATGCTGGTTGAATGGTGCTGCTGCTTGTCTCAAACAGAGTTA
TTTCCAGGAAGCAATCAAGCAATGTTGCAAGGTCTTAGAAGTTGAATCCTGCAATGTGAAAGCATTATATAGGAGAGCGCAAGCATTTAT
GGAAACAGCTGATCTGCACTTGGCTGAACTGGATATCAAGAAGGCACTAGCAATAGAGCCACAAAACAGGGAGGTGAAACTGATACAGAA
GACACTAAAACAACTCCAATCAGAGAGCAACAAGAGAGACGCAAAGCTCTATACAACAATGTTTGCACGCTTATCAAATGAGAACTCTTC
TGCAGCAAAGAAATTAAAAGTTGAGGAAACGGAGAGCAAGAATGAAGAAAATGTTGGTGAAATCAACAXTGCACTGACATTTAATTGGAA
GTTGAATCTAGATGAAGAATCXGTACTTGTATACATATTTTCTAAAGCTGACAGAGXTCTTGATCCAGGAGTCTACAGGAAACAACCTCT
TTACTCCACTTACCCTGTAAAGGTAGGGGTAAGGTCTGTGTACACCCCACCCTTTCTAGATGTCACTTGTTTTGGXGAATATATTGGGTA
TGTTGTTAACGCGAGCATGTATAGCCAAGGTAATAGAGAAAGGCTTTCCATCCAAGGAACCACACTTGTACCTCTGGAAATAGCTGGTTT
TCAGTTCtATTTTAAATGTAAAAATTTGG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan