Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U235590

Score 
189
Direction 
Forward
Predicted Peptide Sequence 
MIETSYKDECEKQIRGKNKSKIKPETPFYDAAHSCKQAQQNKSFKCDYSLGIDLFFVALTRSALKHPSSAGR
Predicted Coding Sequence 
ATGATAGAGACCAGTTACAAAGATGAATGTGAAAAACAAATAAGAGGGAAGAACAAGAGTAAAATAAAACCAGAAACTCCCTTCTATGAC
GCXGCACATTCATGTAAGCAGGCTCAGCAAAATAAGAGCTTCAAGTGTGACTACTCTTTAGGCATTGATCTCTTTTTTGTTGCTTTGACA
AGGTCAGCCTTGAAGCACCCAAGTTCAGCTGGTAGGTAA\
Edits in Original Sequence 
AACGTTAATTTCCACATTTAATATGAATCACTTATTATGTTACACAATCGATTACTAATCAATTCATTTTAACATGAGACACCTTACTAT
CAAGTTGCTAGCATTAAAAATGATAGAGACCA
(5')ATGATAGAGACCAGTTACAAAGATGAATGTGAAAAACAAATAAGAGGGAAGAAC
AAGAGTAAAATAAAACCAGAAACTCCCTTCTATGACGCXGCACATTCATGTAAGCAGGCTCAGCAAAATAAGAGCTTCAAGTGTGACTAC
TCTTTAGGCATTGATCTCTTTTTTGTTGCTTTGACAAGGTCAGCCTTGAAGCACCCAAGTTCAGCTGGTAGGTAA\(3')AGTAAGACTG
AGTACGTTTTGTATTTGTTTTGGTTGCAGAAGCTAATATCTAATAGGACCATCCAAACTCCCTGATGCAAACTGCCGAACAATAGGATTA
GTTGATGTGGAGAACTCATGAGTCATTCCCTGCCAGACAACCTTACCTTCATAAAGAAATATTAGCCTGTCGACAGCTCTTTTAATAGTA
CTGTGTTGATGTGTGACAACAACATATGATGCAATCTTCCCAGGCTTCCCAAGTGCATCCTCGCCTGCCACGTGAACCGAGCGAATGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan