Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U235606

Score 
158
Direction 
Reverse
Predicted Peptide Sequence 
ICNIPLNQIILLRFSLEIPRNDRSQGIFLSSYPTFTLLALYDADWALVVKLEDLSVVASSLLVVLPFLGNPRNKLPSPFNPGEAEYRSMH
HVTAELVGTVHADLSVPPFLPITVNSDSKAAISIAKNPVFQERTKHVKVDSHSXETTAVDGLX
Predicted Coding Sequence 
XACATATGCAACATCCCTCTGAATCAGATTATCTTGTTGCGCTTCAGTCTTGAGATACCTAGAAATGATCGAAGTCAAGGAATTTTTCTC
TCCTCATATCCCACCTTTACTCTATTAGCTTTGTACGACGCCGATTGGGCTCTTGTCGTAAAACTCGAAGATCTGTCAGTGGTTGCTTCA
TCACTTTTGGTGGTGCTCCCATTTCTTGGAAATCCAAGAAACAAGCTTCCATCTCCCTTTAATCCXGGTGAAGCAGAGTATCGTTCTATG
CACCATGTGACTGCTGAATTGGTTGGTACTGTCCATGCTGATCTCTCTGTTCCTCCATTCCTCCCTATCACAGTGAACTCCGATAGTAAA
GCTGCCATTAGCATAGCCAAAAATCCAGTCTTTCAGGAAAGGACGAAACATGTTAAGGTGGACAGTCACTCCGXTGAGACAACTGCTGTC
GATGGTCTAAXX\
Edits in Original Sequence 
(5')XACATATGCAACATCCCTCTGAATCAGATTATCTTGTTGCGCTTCgAGTCTTGAGATACCTAcGAAATGATCGAAGTCAAGGAATT
TTTCTCTCCTCATATCCCACCTTTACTCTATTAGCTTTGTACGACGCCGATTGGGcCTCTTGTCGTAAAACTCGAAGATCTGTCAGTGGT
TGCTTCATCACTTTTGGTGGTGCTCCCATTTCTTGGAAATCCAAGAAACAAGCTTCCATCTCCCTTTAATCCXGGTGAAGCAGAGTATCG
TTCTATGCACCATGTGACTGCTGAATTGGTTGGTACgTGTCCATGCTGATCTCTCTGTTCCTCCATTCCTCCCTATCACAGTGAACTCCG
ATAGTAAAGCTGCCATTAGCATAGCCAAAAATCCAGTCTTTCAGGAAAGGACGAAACATGTTAAGGTGGACAGTCACTCCGXTGAGACAA
CTGCTGTCGATGGTCTAAXX\(3')CTCCGTGAGACAACTGCTGTCGATGGTCTAATCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan