ESTScan Details for Unigene SGN-U235638

Score 
37
Direction 
Reverse
Predicted Peptide Sequence 
KDQKMTIVIVSHSIKQIQRIADIVCLLVDGDIVEIIKPDQLSEGKHPMAQDFFNSAPSVILGKSRTRDKESTSRHELAEKHDNGXAREIQ
VTKIWKNLNPFDEPILTEVNLATETTVEKYTLIKKVFYLPRQSFRWRNQEKRGKFL
Predicted Coding Sequence 
XXGAAGGATCAGAAGATGACAATTGTGATAGTTTCTCATAGCATCAAGCAAATACAGAGAATAGCTGATATAGTGTGCCTGCTGGTTGAT
GGGGACATTGTGGAAATTATAAAGCCTGATCAACTCTCTGAAGGTAAGCATCCCATGGCACAAGATTTCTTCAACTCAGCTCCTAGTGTX
ATTTTAGGCAAAAGTAGAACCAGGGACAAGGAAAGTACATCAAGGCACGAACTAGCGGAGAAGCATGATAATGGTXTAGCAAGAGAGATT
CAAGTCACCAAAATATGGAAGAATCTCAACCCATTCGATGAGCCAATCTTAACTGAGGTTAATTTAGCTACTGAAACTACTGTAGAAAAA
TACACTTTAATAAAAAAGGTATTTTACCTCCCACGACAATCTTTCCGATGGCGCAACCAAGAAAAACGGGGCAAATTCTTGTAA\
Edits in Original Sequence 
(5')XXGAAGGATCAGAAGATGACAATTGTGATAGTTTCTCATAGCATCAAGCAAATACAGAGAATAGCTGATATAGTGTGCCTGCTGGT
TGATGGGGACATTGTGGAAATTATAAAGCCTGATCAACTCTCTGAAGGTAAGCATCCCATGGCACtAAGATTTCTTCAACTCAGCTCCTA
GTGTXATTTTAGGCgAAAAGTAGAACCAGGGACAAGGAAAGTACATCAAGGCACGAACTAGCGGAGAAGCATGATAATGGTXTAGCAAGA
GAGATTCAAGTCACCAAAATATGGAAGAATCTCAACCCATTCGAgTGAGCCAATCTTAACTGAGGTTAATTTAGCTACTGAAACTACgTG
TAGAAAAATACACTTTAATAAAAAAGGTATTTTACCTCCCACGACAATCTTTCCGATGGCGCAACCAAGAAAAACGGGGCAAATTCTTGT
AA\(3')CACGACAATCTTTCCGATGGCGCAACCAAGAAAAACGGGGCAAATTCTTGTAAAGGTTTTAAATAGAAATATGAATTAATATC
ACCAAGAATGATATTCTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan