ESTScan Details for Unigene SGN-U235703

Score 
104
Direction 
Forward
Predicted Peptide Sequence 
KSLSXLEHFIVSYNQLTGPLPSSRSMFSTSHPSSFVGNQGLCGTIIHNPCMTDEFKDGKTDFSNHSKKTDGALIVWIASX
Predicted Coding Sequence 
AAAAGTCTATCAXCGTTGGAACACTTCATCGTGTCGTATAATCAGCTCACTGGTCCATTGCCTTCTTCAAGGTCTATGTTCTCAACGTCC
CATCCATCGTCTTTCGTTGGAAACCAAGGTCTTTGTGGTACTATCATACATAATCCATGCATGACAGATGAATTCAAAGATGGAAAAACA
GATTTTTCGAACCATTCAAAGAAAACAGATGGTGCATTGATAGTATGGATCGCGTCTGXX\
Edits in Original Sequence 
(5')AAAAGTCTATCAXCGTTGGAACACTTCATCGTGTCGTATAATCAGCTCACTGGTCCATTGCCTTCTTCAAGGTCTATGTTCTCAAC
GTCCCATCCATCGTCTTTCGTTGGAAACCAAGGTCTTTGTGGTACTATCATACATAATCCATGCATGACAGATGAATTCAAAGATGGAAA
AACAGATTTTTCGAACCATTCAAAGAAAACAGATGGTGCATTGATAGTATGGATCGCGTCTGXX\(3')TCGCGTCTGCAGCGTTCGGAG
TAATAATTGTCATTCTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan