Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U235713

Score 
562
Direction 
Reverse
Predicted Peptide Sequence 
LIKLREEAASLQNAAATVGENEDDADGDNIVEKLSELYERLQLMGSDAAEAQASKILAGLGFTKEMQGRATRSFSGGWRMRISLARALFV
QPTLLLLDEPTNHLDLRAVLWLEEYLCRWKKTLVVVSHDRDFLNTVCGEIIHLHDMKLHFYRGNFDDFESGYEQRRKEMNKKFEIYDKQL
KAAKRSGSEHNRRR
Predicted Coding Sequence 
AXGTTAATCAAGCTCCGAGAAGAGGCTGCATCTTTACAGAATGCTGCTGCAACTGTTGGTGAGAATGAAGATGATGCTGATGGGGACAAC
ATTGTAGAAAAACTTTCTGAACTGTACGAAAGGTTGCAGCTGATGGGATCAGATGCTGCTGAGGCCCAAGCATCAAAAATTCTTGCTGGG
CTGGGTTTCACCAAGGAAATGCAGGGGCGTGCTACCCGATCTTTTAGTGGTGGTTGGAGGATGAGAATTTCTCTAGCACGGGCTCTTTTT
GTTCAGCCTACTCTATTGTTGTTGGATGAACCTACAAATCATCTTGACCTTCGGGCTGTTCTATGGTTAGAGGAGTACTTGTGCAGATGG
AAGAAAACTTTGGTCGTTGTTTCACATGATCGAGACTTTCTGAACACTGTTTGCGGTGAGATTATTCATCTCCATGACATGAAACTACAC
TTCTATCGTGGTAACTTTGATGATTTTGAAAGTGGATATGAACAGCGTCGCAAAGAGATGAACAAGAAATTTGAGATTTATGATAAGCAG
TTAAAAGCTGCCAAGAGATCTGGAAGTGAGCACAACAGGAGAAGGTAA\
Edits in Original Sequence 
(5')AXGTTAATCAAGCTCCGAGAAGAGGCTGCATCTTTACAGAATGCTGCTGCAACTGTTGGTGAGAATGAAGATGATGCTGATGGGGA
CAACATTGTAGAAAAACTTTCTGAACTGTACGAAAGGTTGCAGCTGATGGGATCAGATGCTGCTGAGGCCCAAGCATCAAAAATTCTTGC
TGGGCTGGGTTTCACCAAGGAAATGCAGGGGCGTGCTACCCGATCTTTTAGTGGTGGTTGGAGGATGAGAATTTCTCTAGCACGGGCTCT
TTTTGTTCAGCCTACTCTATTGTTGTTGGATGAACCTACAAATCATCTTGACCTTCGGGCTGTTCTATGGTTAGAGGAGTACTTGTGCAG
ATGGAAGAAAACTTTGGTCGTTGTTTCACATGATCGAGACTTTCTGAACACTGTTTGCGGTGAGATTATTCATCTCCATGACATGAAACT
ACACTTCTATCGTGGTAACTTTGATGATTTTGAAAGTGGATATGAACAGCGTCGCAAAGAGATGAACAAGAAATTTGAGATTTATGATAA
GCAGTTAAAAGCTGCCAAGAGATCTGGAAGTcGAGCACAACAGGAGAAGGTAA\(3')AAGACCGAGCCAAATTTGTAGCTTCCAAAGAA
TC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan