ESTScan Details for Unigene SGN-U235736

Score 
152
Direction 
Forward
Predicted Peptide Sequence 
MVEKNIVSWNSVLGGYVKSGDLTMAQSVFDEMPEKDVISWNSMVSGYARMGNIERANALFRQMPERSSASWNAMISGYIECGKIEFARSF
FEAMDKKNNVSYSYRFLDTQKMEX
Predicted Coding Sequence 
ATGGTTGAGAAAAATATTGTATCGTGGAATTCAGTGTTAGGTGGATATGTCAAATCTGGTGACTTAACAATGGCACAAAGTGTTTTTGAT
GAGATGCCGGAGAAGGATGTTATTTCGTGGAACTCCATGGTGTCTGGGTATGCGAGGATGGGGAATATAGAGCGGGCAAATGCATTGTTT
AGACAGATGCCGGAGAGAAGTTCTGCCTCTTGGAATGCAATGATTAGCGGATATATAGAGTGTGGGAAGATAGAGTTTGCACGCAGTTTC
TTTGAGGCAATGGACAAAAAGAATAATGTTTCATATTCATATAGATTTCTGGATACTCAAAAAATGGAGATX\
Edits in Original Sequence 
TAGGTCCGAGTACATTTGCTGTATCGTCTGCTTTAAAGGCTTGTGCAAGGATTTTGTATAGGTCTGGTGGGATATCGATTCATGCACAAG
TTTTTAAGTATGGCTTTTGTAATGTTGTTTATGTGCGGACAGCTCTAGTAGATTTTTACTCGAAAGTAGGTAATATGGATTTTGCCCGGA
GCATCTTTGATG
(5')ATGGTTGAGAAAAATATTGTATCGTGGAATTCAGTGTTAGGTGGATATGTCAAATCTGGTGACTTAACAATGGC
ACAAAGTGTTTTTGATGAGATGCCGGAGAAGGATGTTATTTCGTGGAACTCCATGGTGTCTGGGTATGCGAGGATGGGGAATATAGAGCG
GGCAAATGCATTGTTTAGACAGATGCCGGAGAGAAGTTCTGCCTCTTGGAATGCAATGATTAGCGGATATATAGAGTGTGGGAAGATAGA
GTTTGCACGCAGTTTCTTTGAGGCAATGGACAAAAAGAATAATGTTTCATATaTCATATAGATTTCTGGATACTCAAAAAATGGAGATX\
(3')GAGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan