Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U235792

Score 
327
Direction 
Forward
Predicted Peptide Sequence 
MGHTFLKXEKIVYSSSPYPNXGPDEWVRERKNGVFEGAKRFELEDLLRASAEMLGKGGFGTAYKAVLDDGNVVAXEKIERIECLWEKRNL
STNGSFXKT
Predicted Coding Sequence 
ATGGGTCACACATTCTTGAAGGXTGAGAAGATTGTATACTCGTCTAGCCCGTATCCTAATXACGGGCCAGACGAGTGGGTTCGAGAGAGG
AAAAATGGTGTTTTTGAAGGGGCGAAGAGGTTTGAGCTTGAGGATTTGTTGAGAGCTTCAGCTGAGATGTTGGGAAAAGGAGGATTTGGG
ACTGCTTATAAGGCTGTGTTGGATGATGGAAATGTTGTGGCTGXTGAAAAGATTGAAAGAATTGAATGTTTGTGGGAAAAGAGAAATTTG
AGCACAAATGGAAGTTTTANGAAGACTTAG\
Edits in Original Sequence 
GGTCCCAAAAATACCCATCATAGTAGTGGTAAAATGAGCTCATTAGCAATAATCGCTATCATACTAGGTGATGTGTTGGTTCTGTGTGTT
GTGTGTATTTTTCTCTACTGTTTCTTCTGCATTAGGAAAGTTTCTTCACAGAA
(5')ATGGGTCACACATTCTTGAAGGXTGAGAAGATT
GTATACTCGTCTAGCCCGTATCCTAATXACGGGCCAGACGAGTGGGTTCGAGAGAGGAAAAATGGTGTTTTTcGAAGGGGCGAAGAGGTT
TGAGCTTGAGGATTTGTTGAGAGCTTCAGCTGAGATGTTGGGAAAAGGAGGATTTGGGACTGCTTATAAGGCTGTGTTGGATGATGGAAA
TGTTGTGGCTGXTGAAAAGATTGAAAGAATTGAATGTTTGTGGGAAAAGAGAAATTTGAGCACAAATGGAAGTTTTANGAAGACTTAG\
(3')AGACACCCAAATTTGGTTAGTTTGAAAGCATATTACTTTGCTAGAGATGAGAAAAGTGTGGTGTATGAGTTCATGACTAATGGGCAC
TTGTTTGGGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan