ESTScan Details for Unigene SGN-U235831

Score 
280
Direction 
Forward
Predicted Peptide Sequence 
KRLGFCXKEMIKKGFTPTLETYHALIKGFLKRKKYSEAKELFEEMRRYGLLADKEFYSIFADMNYEQGNFDLALELCDEAVEKCLTDKTD
NRNDDGCXDMILHPVAIFGTSDKKLVXLAPNDANLFRAEVSSSCVTLEVKGGPXESPLKQSRLDQKEACKLGVVDLEFYX
Predicted Coding Sequence 
AAGAGGCTTGGTTTTTGCAXCAAGGAAATGATCAAAAAGGGATTCACTCCGACATTAGAGACTTATCATGCACTCATCAAAGGGTTTTTA
AAGAGGAAAAAGTATTCTGAGGCGAAAGAATTGTTTGAAGAGATGAGAAGATATGGTTTATTGGCAGATAAAGAATTTTACTCTATCTTT
GCGGATATGAACTATGAACAAGGGAACTTTGATTTGGCGCTTGAGCTTTGTGATGAAGCAGTAGAAAAATGTCTTACAGACAAGACTGAT
AACAGGAATGATGATGGTTGTXCTGACATGATTCTGCATCCTGTAGCTATTTTTGGAACCAGTGACAAAAAACTAGTTGXTCTTGCTCCC
AATGATGCTAATCTTTTTCGTGCTGAAGTCAGTTCAAGTTGTGTTACTCTGGAGGTGAAGGGAGGACCAXATGAATCACCTTTAAAACAA
TCCCGCTTGGATCAGAAAGAAGCATGCAAGCTAGGTGTCGTGGACTTGGAGTTCTACTXX\
Edits in Original Sequence 
(5')AAGAGGCTTGGTTTTTGCAXCAAGGAAATGATCAAAAAGGGATTCACTCCGACATTAGAGACTTATCATGCACTCATCAAAGGGTT
TTTAAAGAGGAAAAAGTATTCTGAGGCGAAAGAATTGTTTGAAGAGATGAGAAGATATGGTTTATTGGCAGATAAAGAATTTTACTCTAT
CTTTGCGGATATGAACTATGAACAAGGGAACTTTGATTTGGCGCTTGAGCTTTGTGATGAAGCAGTAGAAAAATGTCTTACAGACAAGAC
TGATAACAGGAATGcATGATGGTTGTXCTGACATGATTCTGCATCCTGTAGCTATTTTTGGAACCAGTGACAAAAAACTAGTTGXTCTTG
CTCCCAATGATGCTAATCTTTTTCGTGCTGAAGTCAGTTCAAGTTGTGTTACTCTGGAGGTGAAGGGAGGACCAXATGAATCACCTTTAA
AACAATCCCGCTTGGATCAGAAAGAAGCATGCAAGCTAGGTGTCGTGGACTTGGAGTTCTACTXX\(3')TGCAGTGAAGTATACTAGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan