ESTScan Details for Unigene SGN-U235952

Score 
456
Direction 
Forward
Predicted Peptide Sequence 
LKAKTNAERRFVEKDILSAKNYALKAQMLYPHLEGISQMVATFGVLSAAETKVNGEYDFYAILGLDSSVDKAKLKKQYKKMAVLLHPDKN
KSVGADGAFRLVSEAWTVLSDVSKRSSYDHRRSLFTLHGSGVGSYDSYSNSSVSHNRLDTFWTVCTSCHVQYEYLRKYLNKRLSCKNCRG
VFIAAET
Predicted Coding Sequence 
TTGAAAGCTAAAACAAATGCTGAAAGGAGATTCGTGGAGAAAGACATTTTGAGTGCAAAAAATTATGCTCTGAAAGCTCAGATGTTGTAC
CCTCACTTGGAAGGAATATCACAAATGGTAGCGACCTTTGGAGTCCTTAGTGCTGCAGAGACGAAGGTTAATGGAGAATATGATTTCTAT
GCAATACTGGGTTTAGATTCCTCTGTTGACAAGGCCAAGCTGAAGAAACAGTATAAGAAGATGGCTGTGTTACTCCATCCCGATAAGAAC
AAAAGTGTTGGAGCTGATGGTGCATTTAGACTTGTCTCTGAAGCATGGACGGTGTTGTCTGATGTTTCCAAAAGAAGCTCGTATGATCAC
AGGAGAAGTTTATTTACTCTGCATGGTTCTGGTGTTGGGAGCTATGACAGTTACTCCAATTCATCAGTTTCTCATAACAGGCTGGATACA
TTTTGGACCGTTTGTACCTCTTGTCACGTTCAGTATGAATATCTTAGGAAGTACCTGAACAAAAGGCTGTCCTGTAAGAACTGTCGTGGG
GTTTTCATAGCTGCTGAAACX\
Edits in Original Sequence 
(5')TTGAAAGCTAAAACAAATGCTGAAAGGAGATTCGTGGAGAAAGACATTTTGAGTGCAAAAAATTATGCTCTGAAAGCTCAGATGTT
GTACCCTCACTTGGAAGGAATATCACAAATGGTAGCGACCTTTGGAGTCCTTAGTGCTGCAGAGACGAAGGTTAATGGAGAATATGATTT
CTATGCAATACTGGGTTTAGATTCCTCTGTTGACAAGGCCAAGCTGAAGAAACAGTATAAGAAGATGGCTGTGTTACTCCATCCCGATAA
GAACAAAAGTGTTGGAGCTGATGGTGCATTTAGACTTGTCTCTGAAGCATGGACGGTGTTGTCTGATGTTTCCAAAAGAAGCTCGTATGA
TCACAGGAGAAGTTTATTTACTCTGCATGGTTCTGGTGTTGGGAGCTATGACAGTTACTCCAATTCATCAGTTTCTCATAACAGGCTGGA
TACATTTTGGACCGTTTGTACCTCTTGTCACGTTCAGTATGAATATCTTAGGAAGTACCTGAACAAAAGGCTGTCCTGTAAGAACTGTCG
TGGGGTTTTCATAGCTGCTGAAACX\(3')ACAGGATTGGCTCCGGTTAATGGTTTCTATTCCTATAGCTCTTGGTCTAATGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan