ESTScan Details for Unigene SGN-U235984

Score 
147
Direction 
Forward
Predicted Peptide Sequence 
DDPAAVANCKHEYHSQCIVEWSQTNKECPIXWRVFALKDSASQELLSAMDIERNMRSMINVRHTNQNVETNHDATQQNDSDFEERIMDIL
AAAT
Predicted Coding Sequence 
GATGATCCTGCTGCTGTAGCAAATTGTAAGCATGAATATCATTCGCAGTGTATTGTTGAATGGTCTCAAACAAACAAGGAGTGCCCAATT
TGATGGAGGGTTTTTGCATTGAAAGACTCTGCAAGCCAAGAGCTACTATCTGCGATGGATATTGAAAGGAACATGAGGTCAATGATTAAT
GTGCGTCATACTAACCAAAATGTAGAAACCAATCATGATGCCACACAGCAGAATGATTCAGATTTTGAGGAGCGAATTATGGACATTTTA
GCTGCTGCGACC\
Edits in Original Sequence 
(5')GATGATCCTGCTGCTGTAGCAAATTGTAAGCATGAATATCATTCGCAGTGTATTGTTGAATGGTCTCAAACAAACAAGGAGTGCCC
AATTTGATGGAGGGTTTTTGCATTGAAAGACTCTGCAAGCCAAGAGCTACTATCTGCGATGGATATTGAAAGGAACATGAGGTCAATGAT
TAATGTGCGTCATACTAACCAAAATGTAGAAACCAATCATGATGCCACACAGCAGAATGATTCAGATTTTGAGGAGCGAATTATGcGACA
TTTTAGCTGCTGCGACC\(3')GCTTGTCAACAGAAAGAGAAGACAGGCGTCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan