ESTScan Details for Unigene SGN-U236128

Score 
207
Direction 
Forward
Predicted Peptide Sequence 
PSSLDPAKFVFFFTRRNLEAYNNAYQQQTNLTPKRRLPHAQADRTKKFGASESRHTNRVAFPLSHPLSVPTSPGRTAFLYTSRPDGDLCL
MSELEVTFGGEILSLLTRALPVAASNKVPEMEAEYFPPKQDVILQNEAPTDLYIIVSGAVEFIAQIEGLEQTIGKAVAGEIFGEIGVLCG
RTQPFAVRTTRDFSDSKAKQDIIDEHSSSKX
Predicted Coding Sequence 
XXTCCAAGTTCGCTCGACCCCGCCAAGTTCGTTTTCTTCTTCACAAGAAGAAATCTAGAAGCGTACAACAATGCATATCAGCAGCAAACC
AACCTGACTCCTAAGCGTCGTCTTCCTCACGCGCAAGCGGACAGAACCAAGAAGTTCGGCGCGTCCGAGTCCAGGCACACGAATCGTGTC
GCCTTCCCCCTTTCTCACCCTTTATCCGTCCCTACATCTCCAGGAAGAACAGCCTTTTTGTACACGAGCAGGCCAGATGGAGATCTCTGT
TTGATGTCTGAACTTGAGGTCACCTTTGGTGGTGAAATATTGTCGCTCCTTACTCGTGCTCTCCCGGTCGCTGCCAGCAATAAGGTTCCT
GAAATGGAAGCTGAATACTTCCCTCCGAAGCAAGACGTAATTTTGCAGAATGAGGCACCAACTGATCTGTATATAATAGTTTCAGGAGCA
GTGGAATTTATAGCACAGATTGAAGGGCTAGAGCAAACAATTGGAAAAGCTGTTGCAGGAGAAATATTTGGAGAAATAGGTGTTTTATGT
GGGAGAACACAGCCATTTGCTGTTCGAACAACXCGAGATTTCTCAGATTCTAAGGCTAAACAGGACATCATTGATGAACATTCTTCGAGC
AAATXX\
Edits in Original Sequence 
(5')XXTCCAAGTTCGCTCGACCCCGCCAAGTTCGTTTTCTTCTTCACAAGAAGAAATCTAGAAGCGTACAACAtATGCATATCAGCAGC
AAACCAACCTGACTCCTAtAGCGTCGTCTTCCTCACGCGCAAGCGGACAGAACCAAGAAGTTCGGCGCGTCCGAGTCCAGGCACACGAAT
CGTGTCGCCTTCCCCCTTTCTCACCCTTTATCCGTCCCTACATCTCCAGGAAGAACAGCCTTTTTGTACACGAGCAGGCCAGATGGAGAT
CTCTGTTTGATcGTCTGAACTTGAGGTCACCTTTGGTGGTGAAATATTGTCGCTCCTTACTCGTGCTCTCCCGGTCGCTGCCAGCAATAA
GGTTCCTGAAATGGAAGCTGAATACTTCCCTCCGAAGCAAGACGTAATTTTGCAGAATGAGGCACCAACTGATCTGTATATAATAGTTTC
AGGAGCAGTGGAATTTATAGCACAGATTGAAGGGCTAGAGCAAACAATTGGAAAAGCTGTTGCAGGAGAAATATTTGGAGAAATAGGTGT
TTTATGTGGGAGAACACAGCCATTTGCTGTTCGAACAACXCGAGATTTCTCAGATTCTAAGGCTAAACAGGACATCATTGATGAACATTC
TTCGAGCAAATXX\(3')TCCAGAAGATGAACGGATTATTATAACAATCTATTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan