ESTScan Details for Unigene SGN-U236295

Score 
304
Direction 
Forward
Predicted Peptide Sequence 
LFVLRKDDLGRTFFGDQGPAGQQTTSFLPSEGQFVTYVVGVESCCFGSSCIEQTSFKAIVDSGTSFTFLPDQIYDRVVKEFDRKVNATKA
SFEGYPWQYCYKSSSEGLPKIPSFTLKFTMNSSFXSPGSRIYDLWQQGAVGFCLAVEPSGIDIGTIGQNFMSGYRMVFDRENMKLGWSRS
DCEDLTDNNRLPLAPADGSSPNSLPAEQQNTPNSSRVAPAVAGRTPSNSAAPASRGM
Predicted Coding Sequence 
CTCTTTGTTTTAAGGAAAGACGACTTAGGAAGGACTTTCTTTGGAGACCAAGGGCCTGCTGGCCAGCAGACAACTTCTTTTCTGCCTTCA
GAAGGACAATTTGTTACTTATGTTGTTGGCGTGGAATCATGTTGTTTTGGGAGCTCCTGTATTGAGCAGACGAGCTTCAAAGCCATTGTG
GATAGTGGGACCTCATTTACATTTCTCCCAGATCAAATTTATGATAGAGTTGTTAAAGAGTTTGACAGAAAAGTGAATGCTACGAAAGCT
AGCTTTGAAGGATATCCTTGGCAATATTGCTACAAATCCAGTTCTGAAGGTTTACCGAAGATCCCTTCATTTACTCTGAAGTTCACGATG
AATAGCAGCTTTAXTAGTCCAGGATCCCGTATTTATGATTTATGGCAGCAAGGTGCTGTTGGGTTTTGTTTAGCTGTGGAGCCTTCAGGC
ATAGATATTGGAACGATTGGACAGAACTTCATGTCGGGATATCGCATGGTGTTTGATAGAGAGAACATGAAACTGGGCTGGTCACGCTCT
GACTGTGAAGACCTTACTGATAATAATAGACTGCCATTGGCTCCAGCAGATGGTAGCTCGCCAAACTCACTGCCAGCAGAACAGCAGAAT
ACCCCTAATAGCTCAAGAGTTGCCCCTGCTGTTGCCGGGAGGACGCCCTCAAATTCAGCAGCACCAGCTAGTCGGGGGATG\
Edits in Original Sequence 
(5')CTCTTTGTTTTAAGGAAAGACGACTTAGGAAGGACTTTCTTTGGAGACCAAGGGCCTGCTGGCCAGCAGACAACTTCTTTTCTGCC
TTCAGAAGGACAATTTGTTACTTATGTTGTTGGCGTGGAATCATGTTGTTTTGGGAGCTCCTGTATTGAGCAGACGAGCTTCAAAGCCAT
TGTGGATAGTGGGACCTCATTTACATTTCTCCCAGATCAAATTTATGATAGAGTTGTTAAAGAGTTTGACAGAAAAGTGAATGCTACGAA
AGCTAGCTTTGAAGGATATCCTTGGCAATATTGCTACAAATCCAGTTCTGAAGGTTTACCGAAGATCCCTTCATTTACTCTGAAGTTCAC
GATGAATAGCAGCTTTAXTAGTCCAGGATCCCGTATTTATGATTTATGGCAGtCAAGGTGCTGTTGGGTTTTGTTTAGCTGTGGAGCCTT
CAGGCATAGATATTGGAACGATTGGACAGAACTTCATGTCGGGATATCGCATGGTGTTTGATAGAGAGAACATGAAACTGGGCTGGTCAC
GCTCTGACTGTGAAGACCTTACTGATAATAATAGACTGCCATTGGCTCCAGCAGATGGTAGCTCGCCAAACTCACTGCCAGCAGAACAGC
AGAATACCCCTAATAGCTCAAGAGTTGCCCCTGCTGTTGCCGGGAGGACGCCCTCAAATTCAGCAGCACCAGCTAGTCGGGGGATG\(3')
TGCCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan