Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U236323

Score 
120
Direction 
Reverse
Predicted Peptide Sequence 
VPSTTCMSDEALENPATYXKIGEKTFVFDYDQPDIAIVEQVLSQYMHCPKNSHMEAPLRVVRYIKGIPGMELLMPALDAAGTTDQLMAYC
DSAREHAWKPEDLSQGXLVKLGGAEFPENPRSKKLCLVSAEAEXQKYDKLDCRTYLVGGLFNEQGVQVQQLITLRCDSKEAIQIAANPIF
HERTKHIDIDCHFXMISQGMIKTDHVFTEEQRADVX
Predicted Coding Sequence 
XATGTACCAAGTACAACTTGTATGAGTGATGAGGCACTAGAAAATCCTGCAACATATXCAAAGATTGGTGAGAAGACTTTTGTATTTGAC
TATGATCAGCCTGACATTGCCATTGTAGAACAGGTCTTGAGTCAATATATGCATTGTCCAAAAAATTCTCACATGGAAGCTCCCCTAAGA
GTAGTGAGATACATCAAAGGTATACCAGGAATGGAACTGTTGATGCCTGCTCTTGATGCTGCTGGAACTACAGACCAACTCATGGCCTAT
TGTGATTCAGCTAGGGAACATGCATGGAAACCAGAAGATCTGTCACAGGGTXATCTAGTTAAGCTTGGTGGAGCAGAATTTCCTGAAAAT
CCAAGAAGCAAGAAACTGTGTCTAGTCTCAGCTGAGGCTGAGXTTCAGAAGTATGACAAACTGGACTGCAGAACTTACCTAGTTGGTGGA
CTGTTCAATGAACAGGGAGTTCAAGTTCAACAACTTATAACCTTAAGGTGTGACAGCAAGGAAGCAATTCAAATAGCTGCAAACCCCATA
TTTCATGAAAGAACTAAACATATTGACATTGATTGTCACTTTGXTATGATCAGCCAAGGGATGATTAAAACTGATCATGTATTTACCGAA
GAACAACGGGCAGATGTGCXX\
Edits in Original Sequence 
(5')XATGTACCAAGTACAACTTGTATGAGTGATGAGGCACTAGAAAATCCTGCAACATATXCAAAGATTGGTGAGAAGACTTTTGTATT
TGACTATGATCAGaCCTGACATTGCCATTGTAGAACAGGTCTTGAGTCAATATATGCATTGTCCAAAAAATTCTCACATGGAAGCTCCCC
TAAGAGTAGTGAGATACATCAAAGGTATACCAGGAATGGAACTGTTGATGCCTGCTCTTGATGcCTGCTGGAACTACAGACCAACTCATG
GCCTATTGTGATTCAGaCTAGGGAACATGCATGGAAACCAGAAGATCTGTCACAGGGTXATCTAGTTAAGCTTGGTGGAGCAGtAATTTC
CTGAAAATCCAAGAAGCAAGAAACTGTGTCTAGaTCTCAGCTGAGGCTGAGXTTCAGAAGTATGACAAACTGGACTGCAGAACTTACCTA
GTTGGTaGGACTGTTCAATGAACAGGGAGTTCAAGTTCAACAACTTATAACCTTAAGGTGTGACAGCAAGGAAGCAATTCAAATAGCTGC
AAACCCCATATTTCATGAAAGAACTAAACATATTGACATTGATTGTCACTTTGXTATGATCAGCCAAGGGATGATTAAAACTGATCATGT
ATTTACCGAAGAACAACGGGCAGATGTGCXX\(3')ACGGGCAGATGTGCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan