ESTScan Details for Unigene SGN-U236437

Score 
124
Direction 
Forward
Predicted Peptide Sequence 
RLEQSVSYFCLIGVVRFVIGKKIKVNEEAYRVRTKGDVLIRVLSGYEERKIRSYRLQLQQRLQQAEERKAAVRKIPEQMILSEVRRMVEE
MQALNKKLEDXYWQFMNIQSPSCYLPAKLSGADVTYLPXEFSRSTGRFRMGLNNMFSRTTFTPYTDTLNIECIDPKLGEKRKRRERX
Predicted Coding Sequence 
CGACTCGAGCAATCCGTTTCCTATTTTTGCTTAATTGGAGTTGTGAGGTTTGTTATAGGAAAAAAAATTAAAGTAAATGAAGAAGCTTAT
AGAGTTCGGACGAAAGGCGATGTTCTTATTAGGGTTCTGTCGGGATATGAAGAGCGTAAAATCCGATCGTATCGGTTACAGCTTCAACAG
CGTCTTCAACAGGCAGAAGAGAGAAAGGCAGCTGTAAGGAAGATTCCTGAGCAGATGATTTTATCAGAAGTTAGACGCATGGTAGAAGAG
ATGCAAGCTTTAAATAAGAAGTTAGAAGATXACTACTGGCAGTTCATGAATATTCAAAGTCCAAGCTGTTATCTACCGGCAAAGTTGTCT
GGAGCAGATGTTACTTATCTGCCTGXGGAGTTCTCCCGTTCAACTGGAAGGTTCAGAATGGGGTTAAATAACATGTTCTCTAGAACTACA
TTCACTCCGTACACTGATACTCTGAATATTGAATGTATAGATCCAAAGCTGGGAGAGAAAAGGAAAAGAAGGGAAAGGGXX\
Edits in Original Sequence 
(5')CGACTCGAGCAATCCGTTTCCTATTTTTGCTTAATTGGAGTTGTGAGGTTTGTTATAGGAAAAAAAATTAAAGTAAATGAAGAAGC
TTATAGAGTTCGGACGAAAGGCGATGTTCTaTATTAGGGTTCTGTCGGGATATGAAGAGCGTAAAATCCGATCGTATCGGTTACAGCTTC
AACAGCGTCTTCAACAGGCAGAAGAGAGAAAGGCAGCTGTAAGGAAGATTCCTGAGCAGATGATTTTATCAGAAGTTAGACGCATGGTAG
AAGAGATGCAAGCTTTAAATAAGAAGTTAGAAGATXACTACTGGCAGTTCATGAATATTCAAAGTCCAAGCTGTTATCTACCGGCAAAGT
TGTCTGGAGCAGATGTTACTTATCTGCCTGXGGAGTTCTCCCGTTCAACTGGAAGGTTCAGAATGGGGTTAAATAACATGTTCTCTAGAA
CTACATTCACTCCGTACACTGATACTCTGAATATTGAATGTATAGATCCAAAGCTGGGAGAGAAAAGGAAAAGAAGGGAAAGGGXX\(3')
GGGCCATGCTAATAATAATAAGCCAAGTGGCTCATGAGTGTCGATCAATATTGCTCCCAATCCATACTCGTCTATCTGGTAAGTCAGAA
TCAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan