ESTScan Details for Unigene SGN-U236444

Score 
162
Direction 
Forward
Predicted Peptide Sequence 
DTSFSIPMTYNTNMMSKKCGGLSNLRDLWFEGYEINDINILSALGELRNLEKLILDDNNFNSTIFSSLKIFPSLKHLNLAANEINGNVEM
NDIIDLSNLEYLDLSDNNIHSFATTKGNXKNDFSAEFTI
Predicted Coding Sequence 
XTTGATACCTCATTCAGCATACCGATGACATATAATACTAATATGATGAGTAAGAAATGTGGAGGACTAAGTAATTTAAGAGACCTCTGG
TTTGAAGGCTATGAAATCAATGACATCAATATCCTTTCTGCATTGGGTGAACTCAGGAATTTAGAGAAACTCATTTTGGATGATAATAAC
TTCAATTCCACCATCTTTTCGTCACTCAAGATTTTTCCGTCTCTCAAGCATCTCAATCTCGCTGCCAATGAAATAAATGGAAATGTCGAA
ATGAATGATATAATTGATTTGAGCAATTTGGAATATCTGGATCTCTCGGATAACAATATACACAGCTTTGCGACTACCAAAGGTAACAAX
AAAAATGACTTCTCTGCGGAGTTTACTATT\
Edits in Original Sequence 
(5')XTTGATACCTCATTCAGCATACCGATGACATATAATACTAATATGATGAGTAAGAAATGTGGAGGACTAAGTAATTTAAGAGaACC
TCTGGTTTGAAGGCTATGAAATCAATGACATCAATATCCTTTCTGCATTGGGTGAACTCAGGAATTTAGAGAAACTCATTTTGGATGATA
ATAACTTCAATTCCACCATCTTTTCGTCACTCAAGATTTTTCCGTCTCTCAAGCATCTCAATCTCGCTGCCAATGAAATAAATGGAAATG
TCGAAATGAATGATATAATTGATTTGAGCAATTTGGAATATCTGGATCTCTCGGATAACAATATACACAGCTTTGCGACTACCAAAGGTA
ACAAXAAAAATGACTTCTCTGCGGAGTTTACTATT\(3')TTGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan