ESTScan Details for Unigene SGN-U236491

Score 
247
Direction 
Forward
Predicted Peptide Sequence 
NVHGNHLSGVIPSEVFNISTLQILDLNRNRLTGTLPSSLGLQFPNLQELYLGENELTGSIPSSISNASQLATIYMSLNSFTGSIPNLGNL
RLLKRLFLAENNLTEGTSKGELKFLSYLTNCRHLETVDVSLNQLNGVLPSSLGNLSASLQIFSAFGSKIKGTIPVGVGNLTSLTGMYLDS
NELT
Predicted Coding Sequence 
XTTAACGTCCACGGAAATCACTTGTCAGGTGTCATTCCATCTGAAGTATTCAACATATCGACGTTGCAGATTCTAGACTTAAACAGAAAC
AGGCTCACAGGAACTCTTCCCTCAAGCTTAGGCCTTCAGTTTCCAAATCTGCAAGAGCTTTATTTAGGTGAGAATGAACTTACAGGATCA
ATCCCAAGCTCTATCTCAAATGCTTCACAGCTTGCTACTATATACATGTCCCTCAACTCGTTCACTGGCTCGATACCCAACCTTGGCAAT
TTAAGACTTTTGAAGAGGCTATTTCTAGCAGAGAATAACCTTACAGAGGGAACTTCCAAAGGAGAACTAAAATTCTTGTCCTATTTAACA
AATTGTAGACATTTGGAAACCGTAGACGTGTCTTTAAATCAGTTAAATGGTGTCCTTCCAAGTTCATTAGGGAATCTCTCTGCTAGCCTT
CAAATTTTCTCAGCATTTGGTAGCAAAATCAAGGGGACCATACCTGTGGGAGTTGGAAACTTGACAAGCTTGACCGGTATGTACTTGGAT
AGCAATGAGTTGACX\
Edits in Original Sequence 
(5')XTTAACGTCCACGGAAATCACTTGTCAGGTGTCATTCCATCTGAAGTATTCAACATATCGACGTTGCAGATTCTAGACTTAAACAG
AAACAGGCTCACAGGAACTCTTCCCTCAAGCTTAGGCCTTCAGTTTCCAAATCTGCAAGAGCTTTATTTAGGTGAGAATGAACTTACAGG
ATCAATCCCAAGCTCTATCTCAAATGCTTCACAGCTTGCTACTATATACATGTCCCTCAACTCGTTCACTGGCTCGATACCCAACCTTGG
CAATTTAAGACTTTTGAAGAGGCTATTTCTAGCAGAGAATAACCTTACAGAGGGAACTTCCAAAGGAGAACTAAAATTCTTGTCCTATTT
AACAAATTGTAGACATTTGGAAACCGTAGACGTGTCTTTAAATCAGTTAAATGGTGTCCTTCCAAGTTCATTAGGGAATCTCTCTGCTAG
CCTTCAAATTTTCTCAGCATTTGGTAGCAAAATCAAGGGGACCATACCTGTGGGAGTTGGAAACTTGACAAGCTTGACCGGTATGTACTT
GGATAGCAATGAGTTGACX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan