ESTScan Details for Unigene SGN-U236632

Score 
430
Direction 
Forward
Predicted Peptide Sequence 
FCVPLSTANSGNRPPXMGSSSNAAAPINNVDKGVDYANYFCTYAFLYHQKEMLSDRVRMDAYYNAIFQNKHHFAGKAVLDVGTGSGILAL
WSAQAGARKVYAVEATKMAEHARELVKTNGFEHVVEVIEGSMEDITLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLNPDGVMYPSH
ARMWVAPIRSGLVDQKKIDYDRAMDDX
Predicted Coding Sequence 
TTCTGTGTCCCGCTTTCAACAGCAAACTCTGGTAACCGTCCGCCGXATATGGGTAGCTCTTCTAATGCCGCCGCCCCTATCAACAACGTA
GACAAGGGCGTCGATTATGCTAACTATTTCTGCACTTACGCTTTTCTCTATCACCAAAAAGAGATGCTCTCTGATCGTGTTCGTATGGAT
GCTTACTACAATGCTATTTTCCAAAACAAACATCATTTTGCTGGAAAGGCTGTTTTGGATGTAGGGACAGGGAGCGGCATATTGGCATTA
TGGTCAGCACAAGCAGGTGCAAGGAAAGTTTATGCAGTCGAAGCCACCAAGATGGCAGAACATGCTCGTGAACTTGTTAAAACAAATGGG
TTTGAGCATGTTGTTGAAGTGATTGAGGGGTCAATGGAAGATATTACTCTGCCTGAGAAGGTTGATGTAATCATTTCAGAGTGGATGGGA
TACTTCCTTCTACGTGAATCAATGTTTGACTCAGTTATCTGTGCTCGGGATCGTTGGTTGAACCCAGATGGAGTTATGTACCCAAGCCAT
GCTCGAATGTGGGTTGCACCAATCCGCTCTGGATTAGTGGATCAAAAGAAGATTGATTATGATAGAGCAATGGATGATTGX\
Edits in Original Sequence 
(5')TTCTGTGTCCCGCTTTCAACAGCAAACTCTGGTAACCGTCCGCCGXATATGGGTAGCTCTTCTAATGCCGCCGCCCCTATCAACAA
CGTAGACAAGGGCGTCGATTATGCTAACTATTTCTGCACTTACGCTTTTCTCTATCACCAAAAAGAGATGCTCTCTGATCGTGTTCGTAT
GGATGCTTACTACAATGCTATTTTCCAAAACAAACATCATTTTGCTGGAAAGGCTGTTTTGGATGTAGGGACAGGGAGCGGCATATTGGC
ATTATGGTCAGCACAAGCAGGTGCAAGGAAAGTTTATGCAGTCGAAGCCACCAAGATGGCAGAACATGCTCGTGAACTTGTTAAAACAAA
TGGGTTTGAGCATGTTGTTGAAGTGATTGAGGGGTCAATGGAAGATATTACTCTGCCTGAGAAGGTTGATGTAATCATTTCAGAGTGGAT
GGGATACTTCCTTCTACGTGAATCAATGTTTGACTCAGTTATCTGTGCTCGGGATCGTTGGTTGAACCCAGATGGAGTTATGTACCCAAG
CCATGCTCGAATGTGGGTTGCACCAATCCGCTCTGGATTAGTGGATCAAAAGAAGATTGATTATGATAGAGCAATGGATGATTGX\(3')
G

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan