ESTScan Details for Unigene SGN-U236839

Score 
517
Direction 
Forward
Predicted Peptide Sequence 
TYEVIEQFLEPLKEYGYPELRPLLCIGGVDMKSQTDVVKKGVHIVVATPGRLKDMLAKKKMNLDNCRYLTLDEADRLVDLGFEDDIREVF
DHFKAQRQTLLFSATMPTKIQNFARSALVKPITVNVGRAGAANLDVIQEVEYVKQEAKIVYLLECLQKTPPPVLVFCENKADVDDIHEYL
LXEGVEAVAIHGXKDQEDREYAIATFKSGKKDVLVAPLMCPLRGWDFSEIQHVINYDMPAEIENX
Predicted Coding Sequence 
XAGACGTATGAAGTTATAGAACAATTTTTAGAACCACTCAAGGAGTATGGTTACCCGGAATTGAGGCCTTTGCTATGTATTGGTGGAGTT
GATATGAAGTCCCAAACTGATGTTGTCAAGAAGGGAGTGCACATTGTGGTTGCTACACCTGGAAGGCTCAAAGATATGTTAGCAAAGAAG
AAAATGAACCTTGACAATTGCAGATACTTGACACTGGATGAAGCAGATAGATTGGTCGATCTCGGTTTTGAAGATGATATTAGGGAGGTG
TTTGATCATTTCAAAGCTCAAAGACAAACTCTTCTATTTTCTGCTACAATGCCCACGAAGATCCAGAATTTTGCACGAAGTGCATTAGTT
AAACCAATAACTGTGAATGTGGGGAGGGCTGGAGCAGCTAACCTTGATGTGATTCAGGAAGTCGAGTATGTAAAGCAGGAAGCCAAGATT
GTTTATCTTCTCGAGTGCTTGCAAAAGACTCCACCACCGGTTCTGGTTTTCTGTGAGAATAAGGCTGATGTGGATGATATCCATGAATAT
CTTCTCTTNGAAGGAGTAGAAGCTGTGGCTATTCATGGANGAAAGGATCAAGAGGATAGAGAGTATGCAATTGCGACATTCAAATCAGGC
AAGAAAGATGTTCTAGTTGCXCCACTGATGTGCCCTCTAAGGGGNTGGGATTTTTCTGAGATTCAGCATGTAATTAACTATGATATGCCT
GCCGAAATTGAAAACTAX\
Edits in Original Sequence 
(5')XAGACGTATGAAGTTATAGAACAATTTTTAGAACCACTCAAGGAGTATGGTTACCCGGAATTGAGGCCTTTGCTATGTATTGGTGG
AGTTGATATGAAGTCCCAAACTGATGTTGTCAAGAAGGGAGTGCACATTGTGGTTGCTACACCTGGAAGGCTCAAAGATATGTTAGCAAA
GAAGAAAATGAACCTTGACAATTGCAGATACTTGACACTGGATGAAGCAGATAGATTGGTCGATCTCGGTTTTGAAGATGATATTAGGGA
GGTGTTTGATCATTTCAAAGCTCAAAGACAAACTCTTCTATTTTCTGCTACAATGCCCACGAAGATCCAGAATTTTGCACGAAGTGCATT
AGTTAAACCAATAACTGTGAATGTGGGGAGGGCTGGAGCAGCTAACCTTGATGTGATTCAGGAAGTCGAGTATGTAAAGCAGGAAGCCAA
GATTGTTTATCTTCTCGAGTGCTTGCAAAAGACTCCACCACCGGTTCTGGTTTTCTGTGAGAATAAGGCTGATGTGGATGATATCCATGA
ATATCTTCTCTTNGAAGGAGTAGAAGCTGTGGCTATTCATGGANGAAAGGATCAAGAGGATAGAGAGTATGCAATTGCGACATTCAAATC
AGGCAAGAAAGATGTTCTAGTTGCXCCACTGATGTGCCCTCTAAGGGGNTGGGATTTTTCTGAGATTCAGCATGTAATTAACTATGATAT
GCCTGCCGAAATTGAAAACTAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan