ESTScan Details for Unigene SGN-U236918

Score 
217
Direction 
Forward
Predicted Peptide Sequence 
KYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKIWRMNDTKAWEVDTLRGHMNNVSCVLFHPRQDIIVSNSEDKSIRVWDATKRTGLQTF
RREHDRFWILASHPEMNLLAAGHDSGMIVFKLERERPAFSVSSDSLFYVKDRFLRVYEYST
Predicted Coding Sequence 
XXGAAGTATGTCTTGGAGGGTCATGATAGAGGGGTTAACTGGGCATCATTTCATCCTACACTCCCCCTTATAGTTTCTGGTGCAGATGAT
CGCCAAGTGAAAATTTGGCGGATGAATGATACAAAAGCTTGGGAGGTGGACACGTTGAGAGGACACATGAACAATGTTTCATGCGTTCTA
TTCCATCCAAGGCAAGATATTATTGTTTCAAATTCAGAGGATAAGAGCATCCGAGTGTGGGATGCAACAAAAAGGACTGGTCTTCAGACA
TTCCGCAGGGAGCATGATAGATTTTGGATCCTTGCATCTCATCCAGAGATGAATCTTCTAGCAGCTGGTCATGACAGTGGGATGATAGTA
TTCAAGTTGGAGAGAGAACGGCCTGCATTTTCTGTGAGCAGTGATTCTTTATTTTATGTAAAGGATCGCTTTCTCCGTGTATATGAGTAT
TCAACX\
Edits in Original Sequence 
(5')XXGAAGTATGTCTTGGAGGGTCATGATAGAGGGGTTAACTGGGCATCATTTCATCCTACACTCCCCCTTATAGTTTCTGGTGCAGA
TGATCGCCAAGTGAAAATTTGGCGGATGAATGATACAAAAGCTTGGGAGGTGGACACGTTGAGAGGACACATGAACAATGTTTCATGCGT
TCTATTCCATCCAAGGCAAGATATTATTGTTTCAAATTCAGAGGATAAGAGCATCCGAGTGTGGGATGCAACAAAAAGGACTGGTCTTCA
GACATTCCGCAGGGAGCATGATAGATTTTGGATCCTTGCATCTCATCCAGAGATGAATCTTCTAGCAGCTGGTCATGACAGTGGGATGAT
AGTATTCAAGTTGGAGAGAGAACGGCCTGCATTTTCTGTGAGCAGTGATTCTTTATTTTATGTAAAGGATCGCTTTCTCCGTGTATATGA
GTATTCAACX\(3')ACCCAGAAGGACACACAGTTGATACCAATTAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan