ESTScan Details for Unigene SGN-U236932

Score 
283
Direction 
Reverse
Predicted Peptide Sequence 
ALINAYAQRGLSEQAVNAFRIMKGDGLKPSLLALNSLINAFGEDRKDAEAFAVLKYMKENDMKPDVVTYTTLMKTLIRVEKFERVPAVYE
EMLLSGCIPDRKARAMLRSALKYMKXNIEVVAAASHSNNIDLDES
Predicted Coding Sequence 
XXTGCCTTGATCAATGCCTATGCACAAAGGGGATTGTCTGAACAAGCAGTAAATGCCTTTAGGATTATGAAGGGTGATGGTTTAAAGCCC
AGCCTGTTAGCTCTCAATTCACTAATTAATGCATTTGGTGAGGATCGGAAAGATGCTGAAGCTTTTGCTGTATTGAAGTATATGAAAGAA
AATGATATGAAGCCGGATGTTGTTACTTACACCACTCTCATGAAAACCTTGATACGTGTGGAGAAGTTTGAAAGGGTTCCAGCTGTTTAT
GAAGAAATGTTGTTGTCTGGATGCATCCCAGATAGGAAAGCTAGAGCGATGCTACGATCTGCTTTAAAATACATGAAGXTCAACATTGAA
GTTGTAGCAGCTGCAAGTCACTCTAACAATATTGACCTTGATGAATCATGA\
Edits in Original Sequence 
(5')XXTGCCTTGATCaAATGCCTATGCACAAAGGGGATTGTCTGAACAAGCAGTAAATGCCTTTAGGATTATGAAGGGTGATGGTTTAA
AGCCCAGCCTGTTAGCTCTCAATTCACTAATTAATGCATTTGGTGAGGATCGGAAAGATGCTGAAGCTTTTGCTGTATTGAAGTATATGA
AAGAAAATGATATGAAGCCGGATGTTGTTACTTACACCACTCTCATGAAAACCTTGATACGTGTGGAGAAGTTTGAAAGGGTTCCAGCTG
TTTATGAAGAAATGTTGTTGTCTGGATGCATCCCAGATAGGAAAGCTAGAGCGATGCTACGATCTGCTTTAAAATACATGAAGXTCAACA
TTGAAGTTGTAGCAGaCTGCAAGTCACTCTAACAATATTGACCTTGATGAATCATGA\(3')CCTTGATGAATCATGATTTTTCAGTTTT
AACTTTAAATTTAAGGTAAGGGACTATTCTGTATGTATTTGAAGTAGCATGTTATTACGTTGTGCTTGAGTCAGAAAATATCTTTCCTGG
CGCTTATGTTTTGCTCAAACTAAAAATGTTGAACTTGAAAAATGTAGTTATTTTTGGGTGTTTTGTAATGTAATAACTTATCCTTAATTG
TTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan