ESTScan Details for Unigene SGN-U236938

Score 
145
Direction 
Reverse
Predicted Peptide Sequence 
MINGLGKSGKMKEALHLLNEMKSRGITPNLYTYNTLIFNLGIVGMLEEAGRMYEELQQLGLEPDVFTYNALIRGYSKSGDPDGAYAIYEK
MMVGGCSPNSGTFAQLPXLTADILGSSSEACESEFLNSAVGAAKGLPLLIGRYYLELVDVQQGSWGGAEPQSLSDFILRCSINPNTLSI
Predicted Coding Sequence 
ATGATCAACGGTCTTGGGAAATCTGGTAAAATGAAGGAAGCGCTGCATCTTCTTAATGAGATGAAAAGCAGAGGAATCACCCCGAATCTT
TATACCTATAATACCTTGATATTCAATCTTGGGATTGTTGGAATGTTGGAGGAGGCCGGAAGGATGTATGAAGAACTTCAGCAACTCGGT
CTTGAACCCGATGTTTTTACTTATAATGCTCTTATTAGGGGGTACAGCAAGTCTGGTGATCCAGATGGTGCATATGCCATTTATGAGAAA
ATGATGGTCGGGGGTTGTAGCCCAAATAGTGGTACTTTTGCTCAACTACCTAXATTAACAGCGGACATTTTAGGTTCTTCAAGTGAAGCT
TGTGAGAGCGAGTTCCTAAACTCTGCXGTTGGGGCTGCTAAGGGGTTACCTCTGCTGATTGGACGTTACTATTTGGAGCTTGTAGATGTG
CAGCAAGGTTCTTGGGGCGGGGCTGAACCTCAAAGTCTTTCGGATTTCATTTTAAGGTGCTCTATAAATCCGAATACGTTGTCTATATAA
\
Edits in Original Sequence 
(5')ATGATCAACGGTCTTGGGAAATCTGGTAAAATGAAGGAAGCGCTGCATCTTCTTAATGAGATGAAAAGCAGAGGAATCACCCCGAA
TCTTTATACCTATAATACCTTGATATTCAATCTTGGGATTGTTGGAATGTTGGAGGAGGCCGGAAGGATGTATGAAGAACTTCAGCAACT
CGGTCTTGAACCCGATGTTTTTACTTATAATGCTCTTATTAGGGGGTACAGCAAGTCTGGTGATCCAGATGGTGCATATGCCATTTATGA
GAAAATGATGGTCGGGGGTTGTAGCCCAAATAGTGGTACTTTTGCTCAACTACCTAXATTAACAGCGGACATTTTAGGTTCTTCAAGTGA
AGCTTGTGAGAGCGAGTTCCTAAACTCTGCXGTTGGGGCTGCTAAGGGGTTACCTCTGCTGATTGGACGTTACTATTTGGAGCTTGTAGA
TGTGtCAGCAAGGTTCTTGGGGCGGGGCTGAACCTCAAAGTCTTTCGGATTTCATTTTAAGGTGCTCTATAAATCCGAATACGTTGTCTA
TATAA\(3')GGGGCTGAACCTCAAAGTCTTTCGGATTTCATTTTAAGGTGCTCTATAAATCCGAATACGTTGTCTATATAAATTGTTAA
TATTTGGTTGTTGTAGGTTTATACCTGTGCAGCTTGTAAGAATGAGTGGGCAGTCTTAGCATTAAGTGTAGCATATCTCTTATGCTTGGT
GAATACATGGTGCCTATATCTGTAGATAATTCAACCATATTTGAGGCAAAACTCTTTATAAAGTTTTGATTTGTTATTCAATTTACTAAG
AAATGTAGTGATCTTCTTGTTGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan