ESTScan Details for Unigene SGN-U237039

Score 
520
Direction 
Reverse
Predicted Peptide Sequence 
LKHPQLNLLSLVGGKDNPAETFYYVQIKSVIVGGEVLNIPKETWNLSPEGVGGTIIDSGTTLSYFAEPAYEIVKEAFVKKVKSYPIVQHF
PILNPCYNVSGVKNVEFPSFGIVFGDGAVWNFPVENYFIKLEPDIICLAILGTPRSAXVDNWKLSTAEFSYLIDTKRSRLGYAPTRCADV
Predicted Coding Sequence 
XXTTTGAAGCATCCACAATTGAACTTACTTTCATTGGTTGGTGGCAAAGATAACCCTGCAGAGACTTTCTACTATGTGCAGATAAAATCT
GTCATAGTTGGAGGAGAGGTACTGAATATACCGAAGGAGACGTGGAATTTGTCTCCAGAAGGTGTTGGTGGTACAATCATTGATTCAGGA
ACCACATTGAGTTACTTTGCTGAACCAGCCTATGAGATTGTAAAAGAGGCATTTGTCAAGAAGGTCAAGAGCTATCCCATTGTACAACAC
TTCCCTATTTTGAATCCATGTTACAATGTGTCCGGAGTGAAGAACGTTGAATTTCCCTCGTTTGGAATTGTGTTTGGTGATGGAGCTGTA
TGGAATTTTCCAGTAGAGAACTACTTCATCAAACTTGAACCCGATATCATTTGTTTGGCAATTCTTGGGACTCCTCGGTCTGCTXTTGTC
GATAATTGGAAACTATCAACAGCAGAATTTTCATATCTTATTGACACCAAGAGGTCCAGACTGGGATATGCACCAACAAGATGTGCTGAT
GTTTGA\
Edits in Original Sequence 
(5')XXTTTGAAGCATCCACAATTGAACTTACTTTCATTGGTTGGTGGCAAAGATAACCCTGCAGAGACTTTCTACTATGTGCAGATAAA
ATCTGTCATAGTTGGAGGAGAGGTACTGAATATACCGAAGGAGACGTGGAATTTGTCTCCAGAAGGTGTTGGTGGTACAATCATTGATTC
AGGAACCACATTGAGTTACTTTGCTGAACCAGCCTATGAGATTGTAAAAGAGGCATTTGTCAAGAAGGTCAAGAGCTATCCCATTGTACA
ACACTTCCCTATTTTGAATCCATGTTACAATGTGTCCGGAGTGAAGAACGTTGAATTTCCCTCGTTTGGAATTGTGTTTGGTGATGGAGC
TGTATGGAATTTTCCAGTAGAGAACTACTTCATCAAACTTGAACCCGATATCATTTGTTTGGCAATTCTTGGGACTCCTCGGTCTGCTXT
TGTCGATAATTGGAAACTATCAACAGCAGAATTTTCATATCTTATaTGACACCAAGAGGTCCAGACTGGGATATGCACCAACAAGATGTG
CTGATGTTTGA\(3')ATGACACCAAGAGGTCCAGACTGGGATATGCACCAACAAGATGTGCTGATGTTTGATTTTTTTGTCTAGAATTC
TTGGGGTGGAAGGTGGGAAAATTGTACACATAGTGGATGGAAAAATAGTGTTCATTCTTTCTTGAACATAAAAATACATTGTAGATTAAA
CTGTACTTCCCCTTAAATTTTTTAGATGTAGATGATTTTATGATCTTGGCAACTGAGAAACAGAACTATTATGAAGATTATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan