ESTScan Details for Unigene SGN-U237263

Score 
142
Direction 
Forward
Predicted Peptide Sequence 
RIEKKSSKARNEEEEVEEESHGGDRGENAGEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEVFVTPAVLKECRRI
VVESEIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTAKIGSLVDVNISKDPEGLRIFYYLVXGFEVFRVFSYLTPLQDQTHLSAAISP
PGTEGKPCVLKLLGLLSFALKVRYIFKLINSVDLVIVQVDEVCDMLVXVIEYLFLLLLISPLFRINQWIFRLEPRLTPSDQLLLPVSNLR
RDYCILEXGVGX
Predicted Coding Sequence 
AGAATTGAGAAAAAATCATCTAAGGCTAGGAACGAAGAAGAGGAGGTGGAGGAAGAGAGTCATGGCGGAGACAGGGGAGAAAATGCAGGG
GAGTTTTACTTGAGGTACTATGTCGGCCACAAGGGTAAATTCGGGCATGAGTTCTTGGAGTTCGAGTTTAGGCCCGACGGCAAGCTGCGG
TATGCTAATAATTCCAACTATAAGAACGACACCATGATCCGTAAAGAGGTCTTCGTCACCCCCGCCGTTCTAAAAGAATGCCGTCGCATC
GTCGTTGAAAGCGAGATAATGAAGGAAGATGACAACAATTGGCCAGAACCAGATCGCGTTGGAAGGCAAGAGCTGGAGATTGTAATGGGG
AACGAGCACATATCTTTTACCACTGCTAAGATTGGTTCTCTCGTGGATGTTAATATCAGTAAAGATCCTGAAGGTCTTCGAATCTTCTAT
TATCTTGTTXCAGGATTTGAAGTGTTTCGTGTTTTCTCTTATCTCACTCCACTTCAAGATCAAACCCATTTGAGTGCAGCCATATCACCC
CCTGGAACAGAAGGAAAGCCATGTGTTTTGAAGTTGCTTGGTCTGTTGTCCTTTGCCTTGAAAGTTCGTTATATATTTAAACTTATAAAT
AGCGTTGATTTGGTGATTGTTCAAGTAGATGAAGTTTGTGATATGCTAGTTGXTGTAATTGAATATCTATTCCTTTTGCTCTTGATAAGC
CCTCTTTTCCGCATTAATCAGTGGATCTTCAGGCTTGAGCCTAGGTTGACTCCATCTGATCAGCTCCTCCTTCCTGTTTCTAATTTAAGA
CGTGATTATTGCATCTTGGAAGXTGGTGTAGGTATX\
Edits in Original Sequence 
(5')AGAATTGAGAAAAAATCATCTAAGGCTAGGAACGAAGAAGAGGAGGTGGAGGAAGAGAGTCATGGCGGAGACAGGGGAcGAAAATG
CAGGGGAGTTTTACTTGAGGTACTATGTCGGCCACAAGGGTAAATTCGGGCATGAGTTCTTGGAGTTCGAGTTTAGGCCCGACGGCAAGC
TGCGGTATGCTAATAATTCCAACTATAAGAACGACACCATGATCCGTAAAGAGGTCTTCGTCACCCCCGCCGTTCTAAAAGAATGCCGTC
GCATCGTCGTTGAAAGCGAGATAATGAAGGAAGATGACAACAATTGGCCAGAACCAGATCGCGTTGGAAGGCAAGAGCTGGAGATTGTAA
TGGGGAACGAGCACATATCTTTTACCACTGCTAAGATTGGTTCTCTCGTGGATGTTAATATCAGTAAAGATCCTGAAGGTCTTCGAATCT
TCTATTATCTTGTTXCAGGATTTGAAGTGTTTCGTGTTTTCTCTTATCTCACTCCACTTCAAGATCAAACCCATTTGAGTGtCAGCCATA
TCACCCCCTGGAACAGAAGGAAAGCCATGTGTTTTGAAGTTGCTTGGTCTGTTGTCCTTTGCCTTGAtAAGTTCGTTATATATTTAAACT
TATAAATAGCGTTGATTTgGGTGATTGTTCAAGTAGATGAAGTTTGTGATATGCTAGTTGXTGTAATTGAATATCTATTCCTTTTGCTCT
TGATAAGCCCTCTTTTCCGCATTAATCAGTGGATCTTCAGGCTTGAGCCTAGGTTGACTCgCATCTGATCAGCTCCTCCTTCCTGTTTCT
AATTTAAGACGTGATTATTGCATCTTGGAAGXTGGTGTAGGTATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan