ESTScan Details for Unigene SGN-U237272

Score 
287
Direction 
Forward
Predicted Peptide Sequence 
FFNNITDEDKVNVASRKGWMFTGSEEEVKNGVHLWRDNIKHPCHPLHKCMQSWPDKPASYRKVVGRYVAGNKEAEFDNFGANRARIGIES
GYFDEQSQVQLLSANNYPPCPDPSLTLGILKHLDPSLITIIYQGNVSGLQVLVDGKWMCVEAVPNAFVVNIGNQLEMISNGMLRSVMHRA
VTNSKESRTSIALFVNX
Predicted Coding Sequence 
AGXTTTTTCAACAACATAACTGATGAAGATAAAGTGAATGTAGCAAGCAGAAAAGGATGGATGTTCACAGGGAGTGAGGAAGAGGTTAAA
AATGGTGTTCATTTATGGAGGGATAATATAAAACACCCTTGTCACCCTCTTCACAAATGCATGCAAAGTTGGCCAGATAAACCAGCTAGC
TACAGAAAAGTCGTGGGAAGATATGTTGCXGGAAATAAGGAAGCTGAGTTTGACAATTTTGGAGCTAATAGGGCAAGGATTGGAATTGAA
TCAGGCTACTTTGATGAACAAAGCCAAGTTCAATTATTGTCAGCAAATAATTATCCACCATGTCCAGATCCAAGCTTGACTTTAGGCATA
CTAAAACATCTTGATCCAAGCCTCATAACAATAATATATCAAGGCAATGTAAGTGGACTTCAAGTTTTGGTAGATGGAAAGTGGATGTGT
GTTGAAGCTGTGCCTAATGCTTTTGTTGTAAACATAGGCAATCAATTAGAGATGATCAGCAATGGGATGTTAAGAAGTGTGATGCATAGA
GCAGTAACAAATTCAAAGGAAAGCAGAACATCAATAGCCCTATTTGTGAATCXX\
Edits in Original Sequence 
(5')AGXTTTTTCAACAACATAACTGATGAAGATAAAGTGAATGTAGCAAGCAGAAAAGGATGGATGTTCACAGGGAGTGAGGAAGAGGT
TAAAAATGGTGTTCATTTATGGAGGGATAATATAAAACACCCTTGTCACCCTCTTCACAAATGCATGCAAAGTTGGCCAGATAAACCAGC
TAGCTACAGAAAAGTCGTGGGAAGATATGTTGCXGGAAATAAGGAAGCTGAGTTTGACAATTTTGGAGCTAATAGGGCAAGGATTaGGAA
TTGAATCAGGCTACTTTGATGAACAAAGCCAAGTTCAATTATTGTCAGCAAATAATTATCCACCATGTCCAGATCCAAGCTTGACTTTAG
GCATACTAAAACATCTTGATCCAAGCCTCATAACAATAATATATCAAGGCAATGTAAGTGGACTTCAAGTTTTGGTAGATGGAAAGTGGA
TGTGTGTTGAAGCTGTGCCTAATGCTTTTGTTGTAAACATAGGCAATCAATTAGAGATGATCAGCAATGGGATGTTAAGAAGTGTGATGC
ATAGAGCAGTAACAAATTCAAAGGAAAGCAGAACATCAATAGCCCTATTTGTGAATCXX\(3')CCCACTCCAAACAGCATTGNTGAGCC
AGCAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan