ESTScan Details for Unigene SGN-U237419

Score 
283
Direction 
Forward
Predicted Peptide Sequence 
NVMMTLYMNLKDYDKVESVVSEMKEKRIPLDIYSYNIWLSSCGSQGSIEKMEKVLEQMNLDTDINPNWTTFSTMATMYIKLGQMKKAEDS
LKSVESRITGRDRIPYHYLISLYGSLGKKEDVLRIWKTYQSQFPNIPNLGYHSVISSLVRLDDIEGAEKIYDEWLPVKVHYDPRIGNLLL
GYYGGRGFVDKASAFFDQMIGAXVEAKLNDLRDPC
Predicted Coding Sequence 
AATGTGATGATGACACTCTATATGAACCTTAAAGACTACGACAAGGTTGAATCCGTGGTTTCAGAAATGAAGGAGAAAAGAATTCCACTA
GATATATATTCCTATAATATCTGGTTATCATCATGTGGATCTCAAGGATCTATTGAAAAAATGGAAAAGGTACTCGAACAAATGAATCTA
GACACTGATATCAATCCAAATTGGACTACATTTAGTACCATGGCTACTATGTACATTAAGTTGGGGCAGATGAAAAAAGCTGAAGACTCT
TTGAAAAGTGTTGAGAGCAGAATCACAGGCCGTGATCGAATTCCATATCATTATCTCATCAGTCTCTATGGTAGTCTTGGTAAAAAGGAA
GACGTTCTCCGAATCTGGAAAACCTACCAATCGCAGTTTCCAAATATTCCAAACCTGGGATATCATTCTGTAATATCTTCTCTGGTGAGG
TTGGATGATATTGAAGGTGCAGAAAAAATATATGATGAGTGGCTACCTGTGAAGGTTCACTATGATCCTAGAATAGGAAATCTTTTATTG
GGTTATTACGGAGGAAGGGGTTTCGTGGACAAGGCTAGTGCTTTCTTTGACCAAATGATTGGAGCTGXGGTGGAAGCCAAACTCAATGAC
CTGCGAGATCCTTGC\
Edits in Original Sequence 
(5')AATGTGATGATGACACTCTATATGAACCTTAAAGACTACGACAAGGTTGAATCCGTGGTTTCAGAAATGAAGGAGAAAAGAATTCC
ACTAGATATATATTCCTATAATATCTGGTTATCATCATGTGGATCTCAAGGATCTATTGAAAAAATGGAAAAGGTACTCGAACAAATGAA
TCTAGACACTGATATCAATCCAAATTGGACTACATTTAGTACCATGGCTACTATGTACATTAAGTTGGGGCAGATGAAAAAAGCTGAAGA
CTCTTTGAAAAGTGTTGAGAGCAGAATCACAGGCCGTGATCGAATTCCATATCATTATCTCATCAGTCTCTATGGTAGTCTTGGTAAAAA
GGAAGACGTTCTCCGAATCTGGAAAACCTACCAATCGCAGTTTCCAAATATTCCAAACCTGGGATATCATTCTGTAATATCTTCTCTGGT
GAGGTTGGATGATATTGAAGGTGCAGAAAAAATATATGATGAGTGGCTACCTGTGAAGGTTCACTATGATCCTAGAATAGGAAATCTTTT
ATTGGGTTATTACGtGAGGAAGGGGTTTCGTGGACAAGGCTAGTGCTTTCTTTGACCAAATGATTGGAGCTGXGGTGGAAGCCAAACTCA
ATGACCTGCGAGATCCTTGC\(3')GCCGAAAGCCATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan