ESTScan Details for Unigene SGN-U237523

Score 
315
Direction 
Forward
Predicted Peptide Sequence 
RAGRLNVVLKLFDEMKLCGVAPDVKVYNAVIHALAKGRLVKQARSVMKMMEENDLAPNAVTYNSLIMPLCKARLPDEAQEIFNEMIQRGI
HPTVRTYHALLRSLRTGEEVFEHLQKMNTMGCIPTHDTYXNVNPEVLX
Predicted Coding Sequence 
XCGAGGGCTGGTAGACTCAATGTTGTGCTTAAGCTTTTCGATGAGATGAAATTGTGTGGGGTTGCACCTGATGTTAAGGTTTATAATGCT
GTCATTCATGCTCTTGCAAAAGGCAGGTTGGTTAAACAAGCTAGGAGTGTGATGAAGATGATGGAAGAGAATGATCTTGCTCCAAACGCT
GTTACTTATAACTCATTAATCATGCCTCTCTGCAAAGCTCGATTACCAGATGAAGCTCAAGAGATCTTCAATGAGATGATTCAACGAGGC
ATACATCCTACTGTCCGAACTTACCATGCATTGCTTCGTAGCCTGAGGACAGGGGAAGAAGTGTTCGAGCACTTGCAGAAGATGAACACC
ATGGGATGTATTCCAACTCATGACACTTATXATAATGTTAATCCGGAAGTTTTGCXX\
Edits in Original Sequence 
(5')XCGAGGGCTGGTAGACTCAATGTTGTGCTTAAGCTTTTCGATGAGATGAAATTGTGTGGGGTTGCACCTGATGTTAAGGTTTATAA
TGCTGTCATTCATGCTCTTGCAAAAGGCAGGTTGGTTAAACAAGCTAGGAGTGTGATGAAGATGATGGAAGAGAATGATCTTGCTCCAAA
CGCTGTTACTTATAACTCATTAATCATGCCTCTCTGCAAAGCTCGATTACCAGATGAAGCTCAAGAGATCTTCAATGAGATGATTCAACG
AGGCATACATCCTACTGTCCGAACTTACCATGCATTGCTTCGTAGCCTGAGGACAGGGGAAGAAGTGTTCGAGCACTTGCAGAAGATGAA
CACCATGGGATGTATTCCAACTCATGACACTTATXATAATGTTAATCCGGAAGTTTTGCXX\(3')GCCGATGGTGCCAACTTGATAATG
TTTTCATGTTGTGGGATTAGATGAACCAGATTGGCTTGGACCAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan