ESTScan Details for Unigene SGN-U237566

Score 
205
Direction 
Forward
Predicted Peptide Sequence 
MXMMSCKLLLLFDVLRRSASCSATRTWNSASSISCTPRFKDKLKVTVSIMESKLTMKPKAENTXMAFAXPAYI
Predicted Coding Sequence 
ATGTAGATGATGAGTTGTAAACTTCTCCTCCTTTTTGATGTGCTCCGTCGTTCAGCTTCTTGCTCAGCAACTCGAACATGGAATTCTGCT
TCAAGCATCTCATGTACACCAAGGTTTAAAGATAAGCTCAAGGTAACTGTCTCCATTATGGAGTCCAAATTAACCATGAAGCCTAAAGCT
GAGAATACAGNGATGGCATTTGCTXATCCTGCATATATA\
Edits in Original Sequence 
GAAAACATAAGAAAAATTTTCATTGCTGGGAAGAAAAACTTTGATCTTCAGCTGCACACTCCTTACTAATGCACATAAATCAAAAGTGTG
AATTTAAGGGGATATTCAGAAGGAAACTCTTTTACAGATCTTTTTCAATTAAAGGGTGACATACCGCTACCCGATTCAGCTTAATAGATT
CCTAATCTCTTCTATCTTTTGCATAATCGACAATCCAAGAAAGGCAAATGTAGATGATGAGTTGTAAACTATCTCCTCCTTTTTGATGTG
(5')ATGTAGATGATGAGTTGTAAACTaTCTCCTCCTTTTTGATGTGCTCCGTCGTTCAGCTTCTTGCTCAGCAACTCGAACATGGAATT
CTGCTTCAAGCATCTCATGTACACCAAGGTTTAAAGATAAGCTCAAGGTAACTGTCTCCATTATGGAGTCCAAATTAACCATGAAGCCTA
AAGCTGAGAATACAGNGATGGCATTTGCTXATCCTGCATATATA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan