ESTScan Details for Unigene SGN-U237766

Score 
142
Direction 
Forward
Predicted Peptide Sequence 
LIVAMQNFGSRLIDXIYQPPAAGGGNCDDENYKSLCSICLSEYVKDNTIGTLGCGHEYXRNLHTTMAAEGQEELSNL
Predicted Coding Sequence 
TTAATAGTCGCAATGCAAAACTTTGGTAGTCGTCTCATTGATXTGATCTACCAGCCCCCAGCAGCAGGAGGAGGAAATTGTGATGATGAA
AACTACAAGTCATTGTGTTCCATATGTCTATCTGAATATGTAAAGGACAACACAATTGGTACACTCGGTTGTGGACATGAATATCXACGC
AACTTGCATACAACAATGGCTGCTGAGGGGCAAGAAGAATTGTCCAATCTGTAG\
Edits in Original Sequence 
(5')TTAATAGTCGCAATGCAAAACTTTGGTAGTCGTCTCATTGATXTGATCTACCAGCCCCCAGCAGCAGGAGGAGGAAATTGTGATGA
TGAAAACTACAAGTCATTGTGTTCCATATGTCTATCTGAATATGTAAAGGACAACACAATTGGTACACTCGGTTGTGGACATGAATATCX
ACGCAACTTGCATACAACAATGGCTGCTGAGGGGCAAGAAGAATTGTCCAATCTGTAG\(3')ATCTTCTGTTTAACAGAAACTTTACTT
TTCTTTTTATCAAGTTGTTGTTATTTGAACTTTTTAATATGAACAATTTTTTATTCAGTTTGCTATTTTTTATATGTATTGTTGGTGATT
GAATTCACCTTCTAGAACAATTCTGCAACTCAATTTATGGAATTATTCTTTACAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan