ESTScan Details for Unigene SGN-U237778

Score 
154
Direction 
Reverse
Predicted Peptide Sequence 
KEAKIDEEGVLRIREGVCVPRVDDLIHTILYRLIVXKYSIHPGANKMYRDLKQHFWWSRMKRDIVNFVAQCPNCQQVKYEHQRPGGTLQR
MPIPEWKWERIAMDFVVSHPKTMGRYDSIWVIVDRLTKSAHSISVKVTYNAEKLAKLYILEIVRLHGVPLSIISDRGTQFTSKFWKTVHA
X
Predicted Coding Sequence 
AAAGAAGCAAAAATCGATGAGGAAGGTGTTTTGAGAATAAGGGAAGGAGTATGTGTACCCCGCGTCGATGATTTGATTCACACTATTCTT
TATAGGCTCATAGTTCXGAAGTACTCTATACATCCTGGTGCAAACAAGATGTATCGTGACCTAAAGCAACATTTTTGGTGGAGTAGGATG
AAGCGTGACATTGTTAATTTTGTTGCTCAATGCCCGAATTGTCAGCAAGTAAAGTATGAACACCAGAGGCCTGGAGGGACACTTCAGAGA
ATGCCCATTCCTGAATGGAAGTGGGAGAGAATTGCAATGGACTTCGTGGTTAGTCATCCAAAGACGATGGGTAGGTATGACTCTATTTGG
GTGATTGTTGACAGATTAACTAAGTCTGCTCACTCTATTTCGGTTAAGGTGACTTACAATGCAGAGAAGTTAGCCAAACTTTACATCTTA
GAAATTGTTCGATTGCACGGAGTTCCACTCTCCATCATATCAGATAGAGGTACGCAATTTACTTCTAAGTTTTGGAAAACAGTACATGCC
GAX\
Edits in Original Sequence 
(5')AAAGAAGCAAAAATCGATGAGGAAGGTGTTTTGAGAATAAGGGAAGGAGTATGTGTACCCCGCGTCGATGATTTGATTCACACTAT
TCTTaTATAGGCTCATAGTTCXGAAGTACTCTATACATCCTGGTGCAAACAAGATGTATCGTGACCTAAAGCAACATTTTTGGTGGAGTA
GGATGAAGCGTGACATTGTTAATTTTGTTGCTCAATGCCCGAATTGTCAGCAAGTAAAGTATGAACACCAGAGGCCTGGAGGGACACTTC
AGAGAATGCCCATTCCTGAATGGAAGTGGGAGAGAATTGCAATGGACTTCGTGGTTAGTCATCCAAAGACGATGGGTAGGTATGACTCTA
TTTGGGTGATTGTTGACAGATTAACTAAGTCTGCTCACTCTATTTCGGTTAAGGTGACTTACAATGCAGAGAAGTTAGCCAAACTTTACA
TCTTAGAAATTGTTCGATTGCACGGAGTTCCACTCTCCATCATATCAGATAGAGGTACGCAATTTACTTCTAAGTTTTGGAAAACAGTAC
ATGCCGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan