ESTScan Details for Unigene SGN-U237784

Score 
147
Direction 
Forward
Predicted Peptide Sequence 
VHFWGAVVTLLPHFLSLVQDSSPLTNLXKLDYPFSIHPLNLASDSGFLLFSSTHEPTQGMEWTLLKSVTIAAACTGLCIMSVINFATAEL
GALMLVPMCLMTRPLMLDAKAKTLKSFIRAACNIVLIFLVFPPVAYYLWKGALVGVENARVGDFWNWVESLWTWNSATYIYMCMVHLPCW
Predicted Coding Sequence 
XXTGTCCACTTTTGGGGTGCCGTTGTAACATTACTTCCACATTTTCTGTCTCTAGTACAAGATTCATCACCTCTAACTAACCTCTTXAAG
CTGGATTATCCTTTCAGCATTCACCCTCTTAATCTTGCAAGCGATTCTGGGTTCCTCCTTTTCTCTTCTACACATGAACCAACTCAAGGA
ATGGAATGGACTCTTTTGAAATCAGTCACAATTGCTGCTGCCTGTACTGGACTTTGCATAATGTCAGTCATAAACTTTGCAACTGCAGAA
CTCGGCGCACTCATGCTGGTCCCTATGTGTTTAATGACTAGACCCTTGATGCTCGATGCTAAAGCTAAAACGTTGAAGTCTTTTATTAGG
GCGGCGTGCAATATAGTGTTAATATTTCTGGTTTTTCCTCCTGTAGCTTATTATTTGTGGAAAGGAGCTTTAGTAGGTGTTGAGAATGCA
AGAGTTGGTGACTTTTGGAACTGGGTTGAGTCTCTTTGGACATGGAACAGTGCCACATACATATACATGTGTATGGTTCACCTTCCATGC
TGG\
Edits in Original Sequence 
(5')XXTGTCCACTTTTGGGGTGCCGTTGTAACATTACTTCCACATTTTCTGTCTCTAGTACAAGATTCATCACCTCTAACTAACCTCTT
XAAGCTGGATTATCCTTTCAGCATTCACCCTCTTAATCTTGCAAGCGATTCTGGGTTCCTCCTTTTCTCTTCTACACATGAACCgAACTC
AAGGAATGGAATGGACTCTTTTGAAATCAGTCACAATTGCTGCTGCCTGTACTGGACTTTGCATAATGTCAGTCATAAACTTTGCAACTG
CAGAACTCGGCGCACTCATGCTGGTCCCTATGTGTTTAATGACTAGACCCTTGATGCTCGATGCTAAAGCTAAAACGTTGAAGTCTTTTA
TTAGGGCGGCGTGCAATATAGTGTTAATATTTCTGGTTTTTCCTCCTGTAGCTTATTATTTGTGGAAAGGAGCTTTAGTAGGTGTTGAGA
ATGCAAGAGTTGGTGACTTTTGGAACTGGGTTGAGTCTCTTTGGACATGGAACAGTGCCACATACATATACATGTGTATGGTTCACCTTC
CATGCTGG\(3')GGTTTTGTGTGTTCATACATTATTGTATC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan