ESTScan Details for Unigene SGN-U237928

Score 
423
Direction 
Forward
Predicted Peptide Sequence 
NVDEALRLQRIMEDEGHEPDANAYNIIATGLRKLDLHDVAKRLLLSMVDRGVAPNVLAYTSLIDIYCKQGDFVQAKRTLREMETKGIKPS
TGTYNALVDGYFKHGYFIDAKRALIEIETKGVKPNTTTYTVLIDGYSKQGDFVRAKKTLIEX
Predicted Coding Sequence 
XXTAATGTGGATGAAGCGTTGAGGTTACAGAGAATTATGGAGGATGAAGGACATGAGCCTGATGCAAATGCTTACAATATTATTGCTACT
GGCCTGCGTAAGCTAGATTTGCATGACGTGGCGAAGAGGTTGTTGCTGTCGATGGTGGATCGAGGTGTAGCTCCAAATGTATTGGCTTAT
ACGTCTTTGATTGATATTTACTGCAAGCAGGGAGATTTTGTTCAAGCGAAAAGGACACTTAGAGAGATGGAAACTAAGGGAATTAAGCCT
AGCACGGGAACATACAATGCCCTGGTAGATGGTTACTTCAAGCATGGATATTTTATTGACGCAAAAAGGGCACTTATTGAGATAGAAACT
AAAGGAGTTAAGCCTAACACGACAACATATACTGTGTTGATAGATGGTTATTCTAAGCAAGGAGATTTTGTTAGAGCTAAAAAGACACTT
ATTGAGATX\
Edits in Original Sequence 
(5')XXTAATGTGGATGAAGCGTTGAGGTTACAGAGAATTATGGAGGATGAAGGACATGAGCCTGATGCAAATGCTTACAATATTATTGC
TACTGGCCTGCGTAAGCTAGATTTGCATGACGTGGCGAAGAGGTTGTTGCTGTCGATGGTGGATCGAGGTGTAGCTCCAAATGTATTGGC
TTATACGTCTTTGATTGATATTTACTGCAAGCAGGGAGATTTTGTTCAAGCGAAAAGGACACTTAGAGAGATGGAAACTAAGGGAATTAA
GCCTAGCACGGGAACATACAATGCCCTGGTAGATGGTTACTTCAAGCATGGATATTTTATTGACGCAAAAAGGGCACTTATTGAGATAGA
AACTAAAGGAGTTAAGCCTAACACGACAACATATACTGTGTTGATAGATGGTTATTCTAAGCAAGGAGATTTTGTTAGAGCTAAAAAGAC
ACTTATTGAGATX\(3')TGGAGAATAACGGAGTTAAGCCTAACACCAATACATACACTGCACTGATAGATGGTTATTGCCAGAAAGGTA
TGATGAATGAAGCTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan