Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U237954

Score 
109
Direction 
Forward
Predicted Peptide Sequence 
LVAKGYNQEYGLDYSETFSPVIXAGNHSPGTVTRRRNNWLINQLDVSNAFLHGMLDETIYMTQPPGYVDPRFPQHVCKLQKSLYGLKQAP
RAWYARLKTX
Predicted Coding Sequence 
XGTTTGGTTGCTAAAGGCTACAATCAGGAGTATGGGCTTGATTACTCCGAGACATTCAGTCCTGTTATTCXGGCAGGAAACCATTCGCCT
GGTACTGTCACTCGCCGTCGCAACAATTGGCTCATCAATCAGTTGGATGTTTCCAATGCTTTTCTTCATGGCATGCTTGATGAAACAATC
TACATGACGCAACCACCGGGCTATGTTGATCCTCGCTTCCCTCAACATGTTTGCAAACTCCAGAAGTCTCTGTATGGGCTCAAGCAAGCC
CCCCGTGCTTGGTACGCACGTCTGAAAACGTTX\
Edits in Original Sequence 
(5')XGTTTGGTTGCTAAAGGCTACAATCAGGAGTATGGGCTTGATTACTCCGAGACATTCAGTCCTGTTATTCXGGCAGGAAACCATTC
GCCTGGTACTGTCACTCGCCGTgCGCAACAATTGGCTCATCAATCAGTTGGATGTTTCCAATGCTTTTCTTCATGGCATGCTTGATGAAA
CAATCTACATGACGCAACCACCGGGCTATGTTGATCCTCGCTTCCCTCAACATGTTTGCAAACTCCAGAAGTCTCTGTATGGGCTCAAGC
AAGCCCCCCGTGCTTGGTACGCACGTCTGAAAACGTTX\(3')TCCTCCAGGGACTCGGCTTCACGTGTGGCGTACACGACACGAGTTTG
TTTACTCGATATTCAGCACACGGTACAGTCATTCTTCTTGTCTATGTAGATGATATCATTATTACAGGCTCTACTGCAGCTCTCATTCAG
GATGTCACTCGAGCTATGCATACTAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan