ESTScan Details for Unigene SGN-U238076

Score 
368
Direction 
Reverse
Predicted Peptide Sequence 
RXDLVAWNMLLDAYSKLGKVEEAKSVIERMKENGFYPNVATYGSLANGIALARKPGEALLLWNEIKQRCGMGNGEESTPSSGLLPPLEPD
EGLLDTLADICVRAAFFRKALEIVACMEQHGIPPNKTKFTRIYVEMHSRMFTSKHASRARQDRRKERKRAAEAFKFWLGLPNSYYGSEWR
LDSVIDDEYKSE
Predicted Coding Sequence 
AGGXTTGATTTGGTTGCTTGGAATATGCTGTTAGATGCATACTCTAAGCTAGGAAAGGTTGAGGAAGCAAAGAGTGTGATCGAGAGGATG
AAAGAAAACGGATTCTACCCAAACGTAGCCACTTATGGCAGTCTTGCAAATGGAATAGCTTTGGCTAGGAAGCCGGGAGAAGCACTCTTG
CTTTGGAATGAGATAAAACAGAGGTGTGGAATGGGAAATGGAGAGGAGTCTACTCCGTCTTCAGGCCTCCTCCCGCCATTGGAACCTGAT
GAAGGACTGTTGGATACATTAGCAGACATATGTGTCCGAGCAGCTTTCTTTAGGAAAGCGTTGGAGATCGTTGCTTGCATGGAGCAACAC
GGGATACCACCAAATAAGACCAAGTTTACTAGGATCTACGTCGAGATGCATTCAAGGATGTTTACTAGTAAGCACGCGTCAAGAGCTAGA
CAGGACAGGAGAAAGGAACGAAAACGAGCAGCTGAAGCATTCAAGTTCTGGTTGGGATTGCCCAACTCCTATTATGGAAGTGAATGGCGC
CTTGATTCAGTAATTGACGATGAATACAAATCTGAGTAA\
Edits in Original Sequence 
(5')AGGXTTGATTTGGTTGCTTGGAATATGCTGTTAGATGCATACTCTAAGCTAGGAAAGGTTGAGGAAGCAAAGAGTGTGATCGAGAG
GATGAAAGAAAACGGATTCTACCCAAACGTAGCCACTTATGGCAGTCTTGCAAATGGAATAGCTTTGGCTAGGAAGCCGGGAGAAGCACT
CTTGCTTTGGAATGAGATAAAACAGAGGTGTGGAATGGGAAATGGAGAGGAGTCTACTCCGTCTTCAGGCCTCCTCCCGCCATTGGAACC
TGATGAAGGACTGTTGGATACATTAGCAGACATATGTGTCCGAGCAGCTTTCTTTAGGAAAGCGTTGGAGATCGTTGCTTGCATGGAGCA
ACACGGGATACCACCAAATAAGACCAAGTTTACTAGGATCTACGTCGAGATGCATTCAAGGATGTTTACTAGTAAGCACGCGTCAAGAGC
TAGACAGGACAGGAGAAAGGAACGAAAACGAGCAGCTGAAGCATTCAAGTTCTGGTTGGGATTGCCCAACTCCTATTATGGAAGTGAATG
GCGCCTTGATTCAGTAATTGACGATGAATACAAATCTGAGTAA\(3')GCCCAACTCCTATTATGGAAGTGAATGGCGCCTTGATTCAGT
AATTGACGATGAATACAAATCTGAGTAATTGAAGATGAAAACACAGATATTATACTTGAATATATATGTAGATTTGAAAGTTTGCTGTGT
TATACACAGTTGAAATATAATCTGATACAGCTTTCTACTGGATTCTGTAAGTGTCTCTTCTATCCATGATGGTCAATAGCAATTATATTT
AGTGGTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan