ESTScan Details for Unigene SGN-U238173

Score 
75
Direction 
Forward
Predicted Peptide Sequence 
MVSADFPLFIPARDACYMQSEITPLPPSPPPFSFDTKIKINPPTAIILVTLISVFFAMGIVSVYVRQCADRRFIGDFELADEDSGHAALD
RXGLDPVVITSFPMFFYSDVKHHKIGKSVLECAICLNEFEDAEALRLLPKCSHVFHPNCIDAWLFSHITCPV
Predicted Coding Sequence 
ATGGTTTCTGCTGATTTCCCTTTGTTTATTCCTGCTCGCGATGCATGTTATATGCAATCAGAAATAACACCATTACCACCATCACCACCA
CCATTTTCATTTGATACGAAAATAAAAATCAACCCACCTACGGCTATCATTTTAGTTACACTTATCAGTGTTTTCTTCGCTATGGGAATT
GTTTCAGTCTACGTCCGTCAATGCGCCGACCGCCGCTTCATCGGCGACTTCGAATTAGCAGACGAAGATTCTGGACACGCGGCGCTCGAT
CGCXATGGACTAGACCCAGTCGTAATTACCTCTTTCCCTATGTTTTTTTACTCTGATGTTAAACATCACAAAATTGGGAAATCAGTGTTA
GAATGTGCAATTTGTTTAAACGAATTCGAAGATGCTGAAGCTCTTCGACTTCTTCCTAAATGCTCTCATGTTTTTCATCCAAATTGCATC
GACGCTTGGTTATTTTCTCATATTACCTGCCCTGTT\
Edits in Original Sequence 
GTACTTGTCCATCATTTATTTGATTGTTTTTTTTTTCTAATGAAGATGATAATCGAGCTAAG(5')ATGGTTTCTGCTcGATTTCCCTTT
GTTTATTCCTGCTCGCGATGCATGTTATATcGCAATCAGAAATAACACCATTACCACCATCACCACCACCATTTTCATTTGATACGAAAA
TAAAAATCAACCCACCTACGGCTATCATTTTAGTTACACTTATCAGTGTTTTCTTCGCTATGGGAATTGTTTCAGTCTACGTCCGTCAAT
GCGCCGACCGCCGCTTCATCGGCGACTTCGAATTAGCAGACGAAGATTCTGGACgACGCGGCGCTCGATCGCXATGGACTAGACCCAGTC
GTAATTACCTCTTTCCCTATGTTTTTTTACTCTGATGTTAAACATCACAAAATTGGGAAATCAGTGTTAGAATGTGCAATTTGTTTAAAC
GAATTCGAAGATGCTGAAGCTCTTCGACTTCTTCCTAAATGCTCTCATGTTTTTCATCCAAATTGCATCGACGCTTGGTTATTTTCTCAT
ATTACCTGCCCTGTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan