ESTScan Details for Unigene SGN-U238216

Score 
141
Direction 
Forward
Predicted Peptide Sequence 
ILAKPSLMASLSPFPGKANSIFSPXHPLEIPYSIFYTVYPPFCAAPHDRNSTTSPNNNRYSTQSTPRRNNQQDYRRISTPIKKKADPVTL
SPILAADVDLMSLCNEGKIDQIIEYISQGVDTDFHIFXDIIELLNKIASLDVGEKVHELLLRSPWSNNIELNSKLVKMYVKNGSTRSARK
VFDKMRERKLDLWHLMISGYAKTGDGESGLPLFE
Predicted Coding Sequence 
XGGATTCTGGCAAAACCCTCTCTCATGGCGTCTCTCTCCCCATTCCCTGGAAAGGCTAACTCCATCTTCTCCCCTAAXCATCCACTAGAA
ATTCCGTATTCCATATTCTACACTGTTTATCCACCCTTCTGTGCTGCCCCACACGACCGCAACTCCACCACTTCCCCTAACAACAACCGA
TACTCTACACAATCAACACCTCGCCGCAATAACCAGCAGGATTACAGAAGAATCAGTACTCCTATAAAAAAAAAAGCTGACCCAGTAACA
TTGAGCCCCATTTTAGCAGCTGATGTTGACTTGATGAGTCTATGCAATGAAGGTAAGATTGACCAAATAATTGAGTATATTTCCCAGGGC
GTTGACACTGACTTTCATATTTTTGAXGACATTATTGAGCTATTGAATAAAATTGCTTCATTGGACGTTGGGGAGAAGGTGCATGAGCTC
TTATTGCGTTCCCCATGGAGTAACAATATTGAATTGAACAGTAAGTTAGTAAAAATGTATGTTAAGAACGGAAGCACGAGGAGTGCGAGA
AAAGTGTTTGATAAAATGCGTGAAAGGAAGTTGGACCTGTGGCACTTGATGATTAGTGGGTATGCAAAAACTGGAGATGGGGAGAGTGGT
TTGCCTTTGTTTGAG\
Edits in Original Sequence 
(5')XGGATTCTGGCAAAACCCTCTCTCATGGCGTCTCTCTCCCCATTCCCTGGAAAGGCTAACTCCATCTTCTCCCCTAAXCATCCACT
AGAAATTCCGTATTCCATATTCTACACTGTTTATCCgACCCTTCTGTGCTGCCCCACACGACCGCAACTCCACCACTTCCCCTAACAACA
ACCGATACTCTACACAATCAACACCTCGCCGCAATAACCAGCAGGATTACAGAAGAATCAGTACTCCTATAAAAAAAAAAGCTGACCCAG
TAACATTGAGCCCCATTTTAGCAGCTGATGTTGACTTGATGAGTCTATGCAATGAAGGTAAGATTGACCAAATAATTGAGTATATTTCCC
AGGGCGTTGACACTGACTTTCATATTTTTGAXGACATTATTGAGCTATTGAAtTAAAATTGCTTCATTGGACGTTGGGGAGAAGGTGCAT
GAGCTCTTATTGCGTTCCCCATGGAGTAACAATATTGAATTGAACAGTAAGTTAGTAAAAATGTATGTTAAGAACGGAAGCACGAGGAGT
GCGAGAAAAGTGTTTGATAAAATGCGTGAAAGGAAGTTGGACCTGTGGCACTTGATGATTAGTGGGTATGCAAAAACTGGAGATGGGGAG
AGTGGTTTGCCTTTGTTTGAG\(3')AG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan