ESTScan Details for Unigene SGN-U238349

Score 
400
Direction 
Forward
Predicted Peptide Sequence 
NIVTXSFPEAVEESLPVAGDIQPKIFLPFHALNNRLWSDLFPTMVVEWLMVASVVVVFYEIVHXEEGVKERRRGKREGYGRWSAXKDDAL
RAKEIAERKFLDKDFLGAKRFALKAQSLNPGLEGISQMLATLGVHIAAENKVNGEGNFYGILGVSPKADDEAIRKQYRKLALMLHPDKNK
SIGAEAAFKHX
Predicted Coding Sequence 
AACATTGTCACGXCGTCTTTCCCGGAGGCAGTAGAAGAGTCCTTGCCGGTCGCCGGAGATATTCAGCCAAAAATTTTCTTGCCTTTTCAT
GCTCTAAACAATCGCCTGTGGTCAGATCTCTTCCCAACCATGGTTGTTGAATGGCTGATGGTTGCTTCTGTTGTTGTTGTTTTCTATGAA
ATAGTACATGXAGAAGAAGGGGTAAAAGAGAGAAGAAGGGGTAAAAGAGAAGGGTATGGTAGATGGAGTGCAATXAAAGATGATGCTTTA
AGGGCTAAAGAAATTGCAGAGAGGAAATTCTTGGATAAGGATTTTTTGGGCGCGAAAAGGTTTGCTTTAAAGGCCCAGAGTCTGAATCCT
GGACTTGAAGGTATTAGTCAAATGTTGGCAACACTCGGTGTTCATATTGCTGCTGAGAACAAAGTTAATGGTGAAGGAAATTTTTATGGA
ATCCTTGGTGTTAGTCCAAAAGCTGATGATGAGGCTATAAGGAAACAGTATAGGAAACTGGCCCTCATGCTTCATCCTGATAAGAACAAG
TCCATAGGGGCCGAAGCTGCGTTTAAGCATGXX\
Edits in Original Sequence 
(5')AACATTGTCACGXCGTCTTTCCCGGAGGCAGTAGAAGAGTCCTTGCCGGTCGCCGGAGATATTCAcGCCAAAAATTTTCTTGCCTT
TTCATGCTCTAAACAATCGCCTGTGGTCAGATCTCTTCCCAACCATGGTTaGTTGAATGGCTGATGGTTGCTTCTGTTGTTGTTGTTTTa
CTATGAAATAGTACATGXAGAAGAAGGGGTAAAAGAGAGAAGAAGGGGTAAAAGAGAAGGGTATGGTAGATGGAGTGCAATXAAAGATGA
TGCTTTAAGGGCTAAAGAAATTGCAGAGAGGAAATTCTTGGATAAGGATTTTTTGGGCGCGAAAAGGTTTGCTTTAAAGGCCCAGAGTCT
GAATCCTGGACTTGAAGGTATTAGTCAAATGTTGGCAACACTCGGTGTTCATATTGCTGCTGAGAACAAAGTTAATGGTGAAGGAAATTT
TTATGGAATCCTTGGTGTTAGTCCAAAAGCTGATGATGAGGCTATAAGGAAACAGTATAGGAAACTGGCCCTCATGCTTCATCCTGATAA
GAACAAGTCCATAGGGGCCGAAGCTGCGTTTAAGCATGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan