ESTScan Details for Unigene SGN-U238378

Score 
266
Direction 
Forward
Predicted Peptide Sequence 
SIITEGSQSGPWRKKITDLDGTEDEKDMPWWVVDCVMNNGCLPGKIPNVASTYIHGGFYCSDPYPGKAEWPRILRIHKVVNYVIEKMVLD
KPLDSLNSDGAAGVSGGQVTHPANGGDGIFRTGLKPWQKLKPSIEILCSNQVLSPDMS
Predicted Coding Sequence 
TCAATTATTACTGAGGGTTCTCAAAGTGGTCCATGGAGGAAAAAGATTACCGACTTAGATGGAACAGAAGATGAAAAGGACATGCCATGG
TGGGTAGTGGATTGTGTGATGAACAATGGTTGCCTCCCAGGGAAAATACCAAATGTAGCTTCTACTTACATCCATGGAGGGTTCTACTGT
TCAGATCCTTACCCAGGGAAAGCTGAGTGGCCTCGCATATTAAGAATTCACAAAGTCGTCAACTATGTTATAGAAAAGATGGTTCTTGAT
AAGCCACTGGATAGCCTAAACTCAGATGGAGCTGCTGGAGTGTCTGGTGGACAGGTGACACACCCAGCTAATGGAGGAGATGGCATATTT
CGGACTGGGCTGAAGCCTTGGCAAAAGCTTAAACCATCCATAGAGATATTGTGCAGTAACCAGGTCTTATCCCCTGATATGAGC\
Edits in Original Sequence 
(5')TCAATTATTACTGAGGGTTCTCAAAGTGGTCCATGGAGGAAAAAGATTACCGACTTAGATGGAACAGAAGATGAAAAGGACATGCC
ATGGTGGGTAGTGGATTGTGTGATGAACAATcGGTTGCCTCCCAGGGAAAATACCAAATGTAGCTTCTACTTACATCCATGcGAGGGTTC
TACTGTTCAGATCCTTACCCAGGGAAAGCTGAGTGcGCCTCGCATATTAAGAATTCACAAAGTCGTCAACTATGTTATAGAAAAGATGGT
TCTTGATAAGCCACTGGATAGCCTAAACTCAGATGGAGCTGCTGGAGTGTCTGGTGGACAGGTGACACACCCAGCTAATGGAGGAGATGG
CATATTTCGGACTGGGCTGAAGCCTTGGCAAAAGCTTAAACCATCCATAGAGATATTGTGCAGTAACCAGGTCTTATCCCCTGATATGAG
C\(3')GC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan