ESTScan Details for Unigene SGN-U238439

Score 
154
Direction 
Forward
Predicted Peptide Sequence 
LQVREIRQIWPEKMASDEGTNLDSSRLKFGTPEALEEVRNLTDVGDMTRLLHECIAYQRALDLELDTILSHRSDLDKQLSGLQKCAQVLD
IVKADADHLFSNISSTSLLADQVSAKVRQLDL
Predicted Coding Sequence 
XXCTTACAGGTTCGAGAAATTCGTCAAATTTGGCCGGAAAAAATGGCTTCCGACGAAGGAACCAATTTAGATTCATCTCGGTTGAAATTT
GGGACACCGGAGGCGTTGGAAGAGGTGCGGAATCTCACTGACGTTGGAGACATGACTAGACTTCTCCACGAGTGCATTGCATATCAACGA
GCCCTAGATCTAGAACTGGATACTATCCTTTCACATAGATCTGACCTTGACAAGCAGCTTTCCGGCCTTCAAAAATGCGCTCAAGTTCTC
GACATTGTTAAAGCTGACGCGGATCACTTATTCTCCAACATCAGTTCAACTTCTCTCCTTGCTGATCAGGTAAGCGCAAAAGTCCGTCAG
CTCGATCTX\
Edits in Original Sequence 
(5')XXCTTACAGGTTCGAGAAATTCGTCAAATTTGGCCGGAAAAAATGGCTTCCGACGAAGGAACCAATTTAGATTCATCTCGGTTGAA
ATTTGGGACACCGGAGGCGTTGGAAGAGGTGCGGAATCTCACTGACGTTGGAGACATGACTAGACTTCTCCACGAGTGCATTGCATATCA
ACGAGCCCTAGATCTAGAACTGGATACTATCCTTTCACATAGATCTGACCTTGACAAGCAGCTTTCCGGCCTTCAAAAATGCGCTCAAGT
TCTCGACATTGTTAAAGCTGACGCGGATCACTTATTCTCCAACATCAGTTCAACTTCTCTCCTTGCTGATCAGGTAAGCGCAAAAGTCCG
TCAGCTCGATCTX\(3')TAGGTCAGTCGCGTGTTAACGACACTCTCCTTCGAATAGATGCTATCGTTGATCGCTCTAATTGTTTAGACG
GTGTACGTAAGGCACTTGCATCTGAGGACTTTGAATCTGCTGCTAATTATGTTCAGACGTTCCTTCAACTTGACGCTAAGTACAAGGATT
C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan